KEGG   Treponema brennaborense: Trebr_2545Help
Entry
Trebr_2545        CDS       T01489                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tbe  Treponema brennaborense
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Butirosin and neomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tbe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Trebr_2545
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trebr_2545
   00052 Galactose metabolism
    Trebr_2545
   00500 Starch and sucrose metabolism
    Trebr_2545
   00520 Amino sugar and nucleotide sugar metabolism
    Trebr_2545
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Trebr_2545
   00524 Butirosin and neomycin biosynthesis
    Trebr_2545
Enzymes [BR:tbe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Trebr_2545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3005294..3006250)
Genome map
AA seq 318 aa AA seqDB search
MNYVGVDLGGTNMTAAVLDDSYAVIAQAKRLTSCPRPYDAILDDVARTVLDAVEKAGISP
SDFAYVGVGSPGVVSAADGVVIDAVNLGFKNVPLGSYLSRKLGVRVILENDANAAAYGEF
LAGAAKNTNDFIALTIGTGIGSGVILDKNIYRGANGVGGELGHTVVVLDGRPCSCGRKGC
MDVYASATGLITSTKEAMRADGRSLLWRLVNGDISAVNGASAFSAAKQGDETACAVVASY
VRVLAACVTNIVNIFQPDMISIAGGVSREGEYLLEPVRALVQSECLKNPKGRVPIICAAT
LQDKAGVIGAALLGVRNR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgtcggtgtcgatttaggcggaacgaacatgaccgccgccgttcttgacgat
tcgtacgctgtcatagcgcaggcgaagcgtctcacttcctgtccgcgcccgtacgacgcc
attttggacgacgttgcgcggacggttctcgatgcggttgaaaaggcgggaatatctccg
tccgatttcgcttatgtgggagtcggcagtccgggcgtggtttccgcagcggacggcgtt
gttatcgacgcggtgaatctgggattcaaaaacgttccgctcggttcgtatctgtcgcgg
aaactcggtgtgcgcgtaattttggaaaacgatgcgaacgccgccgcttacggtgaattt
cttgccggcgcggcaaaaaatacgaatgattttattgcgctcacgatcggtaccggaatc
ggcagcggcgttattctggacaaaaatatataccgcggtgcgaacggcgtcggcggtgaa
ttagggcataccgtcgtcgtgctcgacggccgcccctgttcgtgcggaaggaaaggctgc
atggacgtgtacgcttcagcaacgggactcattacaagtacgaaagaagccatgcgtgcg
gacgggcggagtctcctatggcggctggtgaacggtgatatttccgcggtgaacggcgcc
tccgcgttttcggcagcgaagcagggagacgaaacggcctgcgccgtcgtcgcctcgtac
gtgcgcgttctcgcggcgtgcgttacgaatatcgtgaatattttccagcccgatatgatt
tcgattgccggcggcgtaagccgcgaaggcgaatatttgctcgagccggtgcgcgctctg
gttcagtccgaatgtctgaaaaatcccaaaggccgcgttccgatcatctgcgccgcgact
ttgcaggataaagccggcgttatcggtgcggcgctgctgggcgtgcggaatcggtaa

DBGET integrated database retrieval system