KEGG   Thermobispora bispora: Tbis_0150Help
Entry
Tbis_0150         CDS       T01236                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
tbi  Thermobispora bispora
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tbis_0150
   00051 Fructose and mannose metabolism
    Tbis_0150
Enzymes [BR:tbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Tbis_0150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
175636..176781
Genome map
AA seq 381 aa AA seqDB search
MYTPTPEDRFSFGLWTVGWQARDPFGDATRAPLDPVETVHRLAELGAYGVTFHDDDLLAV
EPDRTKAIERFKKALSETGLKVPMATTNLFTHPIFKDGAFTSNDRDVRRYALRKVMRNLD
LAAELGAKTYVCWGGREGAESDAAKDVRAALDRYKEALDILCQYVIDKGYDIRFAIEPKP
NEPRGDILLPTIGHALAFINELEHPERVGLNPEVGHEQMAGLNFVHGIAQALWHGKLFHI
DLNGQHGPRYDQDLIFGHGDLISAFFLVDLLEHGGYDGPRHFDYKPMRTEDKEDVWESAA
ANMRMYLILKEKSKAFRADPEVQEALAAARVPDLSQPTLAEGETIDDLLNEEFDPDAAAE
RGYHYTRLNQLAMEHLLGVRG
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtacacccccaccccggaggaccgcttctcgttcgggctgtggaccgtcggctggcag
gcgcgcgacccgttcggcgacgccacccgggccccgctcgaccctgtcgagaccgtgcac
cgcctcgccgagctcggcgcgtacggcgtgaccttccacgacgacgacctgctcgcggtc
gagccggaccggaccaaggccatcgagcgcttcaagaaggcgctgagcgagaccggcctc
aaggtcccgatggcgaccaccaacctcttcacccacccgatcttcaaagacggcgcgttc
accagcaacgaccgggacgtccggcgctacgccctgcggaaggtcatgcgcaacctcgac
ctcgccgccgagctgggcgccaagacctacgtctgctggggcggccgggagggcgccgag
tcggacgccgccaaggacgtccgggccgcgctcgaccggtacaaggaggccctcgacatc
ctctgccagtacgtcatcgacaagggctacgacatccggttcgccatcgagccgaagccg
aacgagccgcgcggcgacatcctgctgccgaccatcggccacgcgctcgccttcatcaac
gagctcgagcaccccgagcgcgtcggcctcaacccggaggtcggccacgagcagatggcc
gggctgaacttcgtccacggcatcgcccaggcgctctggcacggcaagctcttccacatc
gacctcaacggccagcacggcccgcggtacgaccaggacctcatcttcggccacggcgac
ctgatcagcgcgttcttcctcgtcgacctgctcgagcacggcggctacgacggcccgcgc
cacttcgactacaagccgatgcggaccgaggacaaggaggacgtctgggagtccgccgcc
gcgaacatgcggatgtacctcatcctcaaggagaagtcgaaggcgttccgcgccgacccg
gaggttcaggaggcgctcgccgccgcccgggtccccgacctctcccagccgacgctcgcc
gagggggagaccatcgacgacctcctcaacgaggagttcgacccggacgccgccgcggag
cgcggctaccactacacccggctcaaccagctcgccatggagcatctcctcggcgtccgc
ggctaa

DBGET integrated database retrieval system