KEGG   Thermobispora bispora: Tbis_0211Help
Entry
Tbis_0211         CDS       T01236                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi00010  Glycolysis / Gluconeogenesis
tbi00620  Pyruvate metabolism
tbi00640  Propanoate metabolism
tbi00680  Methane metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01130  Biosynthesis of antibiotics
tbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_0211
   00620 Pyruvate metabolism
    Tbis_0211
   00640 Propanoate metabolism
    Tbis_0211
  Energy metabolism
   00680 Methane metabolism
    Tbis_0211
Enzymes [BR:tbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tbis_0211
Lipid biosynthesis proteins [BR:tbi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tbis_0211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADG86943
JGI: Tbis_0211
UniProt: D6Y2Y2
Position
complement(250801..252780)
Genome map
AA seq 659 aa AA seqDB search
MATETPGRETQETLSNLLTETRRFAPPAELAAAANVTAEAYEEAERDRLAFWERAAERLT
WAERWHTTLEWNAPFAKWFVGGKLNVAYNCVDRHVEAGLGDRVAYYWEGEPEGHSRTITY
AELQREVAKAANALQELGVRKGDRVAIYMPMIPELPIAMLACARIGAIHSVVFGGFSVSA
LKNRIEDANAKLVITADGGYRRGKPNPLKPTVDEAVAECPGVERVVVVRRTGQEVNWTDK
DIWWHDIVDRQPAEHEAVPHDAEDPLFILYTSGTTGKPKGILHTTGGYLTQTSWTHWAVF
DLKPETDIYWCTADIGWVTGHSYIVYGPLANAATSVIYEGTPDTPHRGRFWEIVQKYKVT
ILYTAPTAIRTFMKWGADIPAKFDLSSLRILGSVGEPINPEAYVWYREHIGGNRCPVVDT
WWQTETGAIMITPLPGITHAKPGAAMRALPGIVADVVDDKGESVPNGGGGYLVIREPWPS
MLRTIWGDDKRYVDTYWSRFEGLYFPGDGAKRDEDGDIWLLGRVDDVMLVSGHNISTTEV
ESALVSHPKVAEAAVVGASDPVTGQAIVAFVILRGEAEESEDIAAELRAHVASTLGPIAK
PRQILVVPELPKTRSGKIMRRLLRDVAENRELGDVTTLTDSSVMKLIAEKLPAAKSSED
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
gtggccaccgagaccccaggtcgcgagacccaggagacgctgtcgaacctgctgaccgag
acccggcggttcgcgccaccggccgagctggcagcggccgcgaacgtcaccgcggaggct
tacgaagaggccgaacgggatcggctggccttctgggagcgcgccgcggagcggctgacg
tgggccgagcgctggcacaccacgctcgagtggaacgcgcccttcgccaagtggttcgtc
ggcgggaagctcaacgtcgcctacaactgcgtcgaccgccacgtcgaggccgggctcggt
gaccgggtcgcctactactgggagggcgagcccgaggggcacagccgtacgatcacgtac
gccgagctgcagcgcgaggtggcgaaggcggcgaacgcgctccaggagctcggggtacgc
aagggcgaccgggtcgccatctacatgccgatgatccccgagctgccgatcgcgatgctc
gcctgcgcccgcatcggcgcgatccactccgtggtgttcggcggcttctcggtgtccgcg
ctcaagaaccggatcgaggacgcgaacgccaagctcgtcatcacggccgacggcggctac
cggcgcggcaagccgaacccgctcaagccgaccgtggacgaggcggtggccgagtgcccg
ggtgtggagcgcgtggtcgtcgtgcgccggaccggccaggaggtcaactggacggacaag
gacatctggtggcacgacatcgtcgaccgccagccggccgagcacgaggccgtgccgcac
gacgccgaggacccgctgttcatcctctacaccagcggcaccaccggtaagccgaagggc
atcctgcacaccaccggcggctacctcacccagacctcctggacccactgggcggtcttc
gacctcaagccggagaccgacatctactggtgcaccgcggacatcggctgggtgaccggg
cactcctacatcgtgtacggcccgctcgccaacgcggcgaccagcgtcatctacgagggg
acccccgacaccccgcaccggggccggttctgggagatcgtgcagaagtacaaggtcacg
atcctgtacaccgccccgaccgccatccggacgttcatgaagtggggcgccgacatcccg
gcgaagttcgacctgtcgtcgctccggatcctcgggtcggtgggcgagcccatcaacccc
gaggcgtacgtctggtaccgcgagcacatcggcggcaaccgctgcccggtggtagacacc
tggtggcagaccgagaccggcgccatcatgatcacgccgctcccgggcatcacccacgcc
aagccgggcgccgccatgcgggcgctgccgggcatcgtcgcggacgtggtcgacgacaag
ggcgagtccgtgccgaacggcggtggcggctacctggtgatccgcgagccgtggccgtcc
atgctccgcacgatctggggtgacgacaagcggtacgtcgacacctactggtcgcggttc
gagggcctctacttcccgggcgacggggccaagcgcgacgaggacggcgacatctggctg
ctgggccgggtggacgacgtcatgctggtctccggccacaacatctccaccaccgaggtg
gagagcgccctggtcagccacccgaaggtcgccgaggccgcggtggtgggcgcctccgac
ccggtgaccggccaggcgatcgtggcgttcgtgatcctgcgcggcgaggccgaggagagc
gaggacatcgcggccgagctgcgcgcccacgtcgccagcacgctcggcccgatcgccaag
ccgcgccagatcctggtcgtcccggagctgcccaagacccgctccgggaagatcatgcgc
aggctgctgcgtgacgtcgcggagaaccgggagctcggcgacgtcaccaccctgaccgac
agctcggtgatgaagctaatcgccgagaagctgccggctgccaagagcagcgaggactga

DBGET integrated database retrieval system