KEGG   Thermobispora bispora: Tbis_0263Help
Entry
Tbis_0263         CDS       T01236                                 

Definition
uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin) methyltransferase
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
tbi  Thermobispora bispora
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tbi00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308202..309782
Genome map
AA seq 526 aa AA seqDB search
MSSANHSLEAQSGFVAFVGAGPGDENLLTLRGADLLRRADVVIADRTLHGAMLRHCRDGA
KIVDVGEDGSPAVDAIEEAKAGRTVVRLCPGDPSFFSSVADEISACADAEVEFEIVPGVP
PATAVPTYAGIPPASGVAEFRVVDATKVEDWTPHASCEGTLVIYHGLAEAPAIAKALISG
GKPDSTPVAVVREGTVTAQHTVVSTLGRLGPDLKRADVSEPAMIVVGDAVGMRDRMSWFE
TKPLFGWRVLVPRTKEQAKELTEQLRAYGAVPEEVPTISVEPPRTPQQMDRAIKGLINGR
YEWVVFTSVNAVKALREKFEEYGLDARAFAGLKIAAVGDATARSLMDFGIRPDLVPTGEQ
SSEGLLAEWPPYDSLLDPINRVLLPRADIATDTLIAGLTELGWECDDVTAYRTVRAAPPP
APIREAIKSGGFDAVLFTSSSTVRNLIGIAGKPHNVTVIAVIGPQTAKTAQEFGLRVDVM
AEKPSVSLLAAALAEYGAKMRQAQLAAGETPRRPSQMRRGARRRAK
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
gtgagctccgcgaaccacagtctggaggcccagtccgggttcgtcgccttcgtgggagcc
gggcccggtgacgagaacctgctcacgctacgcggcgccgacctgctgcggcgggccgac
gtggtcatcgccgaccggacgctccacggcgcgatgctgcgccactgccgggacggcgcg
aagatcgtcgatgtgggcgaggacgggtcgcccgcggtcgacgcgatcgaggaggcgaag
gccgggcggaccgtggtacggctctgccccggcgacccgtcgttcttctcgtccgtggcc
gacgagatctccgcgtgcgccgacgccgaggtcgagttcgagatcgtgcccggtgtcccg
cccgccacggcggtgccgacgtacgcgggcatcccgccggcctccggggtggccgagttc
cgggtggtggacgccaccaaggtcgaggactggacgccccacgcctcctgcgagggcacc
ttagtgatctaccacgggctcgccgaggcgcccgcgatcgcgaaggcgctgatcagcggg
ggcaagccggactcgaccccggtcgcggtggtgcgcgagggcacggtgaccgcgcagcac
accgtggtctccacgctcggccggctcggccccgacctgaagcgcgcggacgtctccgag
ccggcgatgatcgtcgtcggggacgcggtgggcatgcgcgaccgcatgtcctggttcgag
accaagccgctcttcggctggcgggtgctcgtcccccgcaccaaggaacaggccaaggag
ctcaccgagcagctccgggcgtacggcgcggtcccggaggaggtgccgacgatctcggtc
gagccgccgcgcaccccgcagcagatggaccgggcgatcaagggcctgatcaacggccgt
tacgagtgggtcgtcttcaccagcgtcaacgcggtgaaggccctgcgggagaagttcgag
gagtacggcctcgacgcccgcgcgttcgccggcctgaagatcgccgccgtgggcgacgcg
accgcgcgctccctcatggacttcggcatccggcccgacctggtgccgaccggtgagcag
tcgtccgagggcctgctcgcggagtggccgccgtacgactcgctgctcgacccgatcaac
cgggtgctgctgccgcgggccgacatcgcgaccgacacgctcatcgccggcctgaccgag
ctcggctgggagtgcgacgacgtcaccgcgtaccggaccgtgcgcgccgcgcccccgccc
gcgcccatccgggaggcgatcaagagcggcgggttcgacgcggtgctgttcacctcgtcg
tccacggtgcgcaacctcatcggcatcgccggcaagccgcacaacgtcacggtgatcgcc
gtgatcggcccgcagaccgcgaagaccgcccaggagttcggcctccgggtcgacgtgatg
gccgagaagccgtcggtctccctgctcgccgcggccctggcggagtacggggccaagatg
cggcaggcgcagctcgccgccggggagacgccccgccgcccgtcccagatgcgcaggggc
gcccggcgccgggcgaagtga

DBGET integrated database retrieval system