KEGG   Thermobispora bispora: Tbis_0517Help
Entry
Tbis_0517         CDS       T01236                                 

Definition
enoyl-CoA hydratase/isomerase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tbi  Thermobispora bispora
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Tbis_0517
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Tbis_0517
   00650 Butanoate metabolism
    Tbis_0517
  Lipid metabolism
   00071 Fatty acid degradation
    Tbis_0517
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tbis_0517
   00310 Lysine degradation
    Tbis_0517
   00360 Phenylalanine metabolism
    Tbis_0517
   00380 Tryptophan metabolism
    Tbis_0517
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Tbis_0517
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Tbis_0517
   00281 Geraniol degradation
    Tbis_0517
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tbis_0517
   00627 Aminobenzoate degradation
    Tbis_0517
   00930 Caprolactam degradation
    Tbis_0517
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Tbis_0517
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
565831..566595
Genome map
AA seq 254 aa AA seqDB search
MADEVLVSVDGGVGVITINRPQAKNAVNAAVARGIADAIDDLDARKDVSVLVLTGAGGTF
SAGMDLKAFLAGELPMIEGRGFGGITEAPPKKPIIAAVEGYALAGGFELVLSCDLIVASE
EAKFGLPEPKRGLVAAAGGVMRLPRRIPYHIAMEIALTGDFYPATRLHELGLVNRITPAG
KALEEATELAKKIAANAPLALAATKKIMVESIDWSLDEMFAKQDEITGPVFTSKDAMEGA
AAFAEKRAPVWKGE
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgaggttctggtaagcgtcgacggcggggtcggcgtcatcaccatcaaccgg
ccgcaggccaagaacgcggtgaacgccgccgtggcccgcgggatcgccgacgccatcgac
gatctggacgcccgcaaggacgtgtccgtgctcgtcctcaccggggcgggaggcacgttc
tccgcgggcatggacctgaaggccttcctcgcgggcgagctgccgatgatcgaggggcgc
ggcttcggcggcatcaccgaggccccgccgaagaagccgatcatcgccgccgtcgagggg
tacgcgctcgccggtgggttcgagctggtcctctcctgcgacctcatcgtcgcctccgag
gaggcgaagttcggcctgccggagcccaagcgcggcctggtcgcggccgccggtggggtg
atgcgtctgccgcggcgtatcccgtaccacatcgcgatggagatcgccctgaccggtgac
ttctacccggccacccggctccacgagctcgggctggtcaaccggatcaccccggcgggc
aaggcgctggaggaggcgaccgagctcgccaagaagatcgcggccaacgccccgctcgct
ctcgcggcgaccaagaagatcatggtcgagtcgatcgactggtcgctcgacgagatgttc
gccaagcaggacgagatcaccggtccggtgttcacctcgaaggacgccatggaaggcgcg
gccgccttcgccgagaagcgcgcgcccgtctggaagggcgagtaa

DBGET integrated database retrieval system