KEGG   Thermobispora bispora: Tbis_0628Help
Entry
Tbis_0628         CDS       T01236                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
tbi  Thermobispora bispora
Pathway
tbi00984  Steroid degradation
tbi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tbis_0628
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Tbis_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_binding_3 HI0933_like GIDA Fer4_9 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ADG87354
JGI: Tbis_0628
UniProt: D6Y5K8
Position
682234..683904
Genome map
AA seq 556 aa AA seqDB search
MDYDVVVVGSGFGGSVAALRLTEKGYSVGVLEAGRRFDEKTLPKTSWRLRDFLWAPALGL
KGIQRIHLLRGESGVLVLAGAGVGGGSLVYANTLYEPLDPFFTDPQWAHITDWKDELAPY
YDQAKRMLGAVVNPSMTPADEVMRKVAERMGVGGTFHLAPVGVFFGEPGVEVDDPYFGGV
GPRRRGCTECGECMTGCRHGAKNMLTKNYLYLAEKAGAKIHPETTVVSVRPITGGYELTV
RRTGVFGRTRTITAGQVVFAAGTYGTQKLLHRLKRTTLPNLSPRLGELTRTNSEALLGFE
RPTTRGPKLNRGVAITSSFHPDAETHIEPVRYGDGSNMMALLRTLLVDGGGRTPRWARFL
GEVARRPHLIPWLFRIRHWSERTVIALVMQAKNNSITVRLRGGRLRAERGHGEPNPTWIP
AGHRAVRIAAEEVGGLPGGTWLDLFNIPATAHFIGGCVIGDSPETGVIDPYHRVYGYEGL
HIVDGSAISANLGVNPSLTITAQAERAMAFWPNKGEPDPRPPLGSPYVRIKPVPPAKPVV
PPSAPGALRLPIVDVT
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggattacgacgtcgtggtcgtcggctcggggttcgggggcagcgtggcggcgctccgg
ctgacggagaaggggtactcggtcggcgtgctggaggcggggcgcaggttcgacgagaag
accctgcccaagacctcctggcgcctgcgggacttcctgtgggcccccgccctggggctg
aaggggatccagcgcatccacctgctgcgcggcgagagcggggtgctggtgctcgccggg
gccggggtcggcgggggctccctggtctacgcgaacacgctctacgagcccctcgacccg
ttcttcaccgacccgcagtgggcgcacatcaccgactggaaggacgagctcgccccctac
tacgaccaggccaagcggatgctcggcgcggtggtcaacccgtccatgaccccggcggac
gaggtcatgcggaaggtcgccgagcggatgggcgtgggcggcaccttccacctcgccccg
gtcggggtgttcttcggcgagcccggggtcgaggtcgacgacccgtacttcggcggggtc
ggcccgcgccgccgcgggtgcaccgagtgcggggagtgcatgaccggctgccgccacggc
gccaagaacatgctcaccaagaactacctctacctggcggagaaggcgggggcgaagatc
cacccggagaccaccgtggtctcggtccggccgatcaccggcgggtacgagctcaccgtg
cgccgcaccggcgtgttcggccgcacccgcacgatcaccgccggccaggtggtcttcgcc
gcgggcacgtacggcacccagaagctgctccaccggctgaagcggacgaccctgccgaac
ctctcgccccggctcggcgagctgacccggaccaactccgaggcgctgctcggcttcgag
cgcccgaccacgagggggccgaagctcaaccgcggcgtggcgatcacctcgtcgttccac
ccggacgcggagacgcacatcgagccggtccggtacggcgacggctccaacatgatggcg
ctgctgcgcacgctcctggtggacgggggcgggcggacgccccgctgggcgcggttcctc
ggcgaggtggcccggcggccgcacctgatcccctggctcttccgcatccgccactggtcg
gagcggaccgtgatcgccctggtcatgcaggcgaagaacaactcgatcacggtgcggctc
cgcgggggccggctccgggccgagcggggccacggcgagccgaaccccacctggatcccg
gccgggcaccgggcggtgcggatcgccgccgaggaggtcggcggcctgcccggcggcacc
tggctcgacctgttcaacatcccggcgaccgcgcacttcatcggcggctgcgtgatcggc
gactccccggagaccggggtgatcgacccctaccaccgggtgtacgggtacgagggcctg
cacatcgtggacggctcggcgatctcggcgaacctgggggtgaacccctcgctcaccatc
accgcccaggccgagcgggccatggcgttctggccgaacaagggcgagcccgacccccgg
ccgccgctcggctcgccgtacgtgcggatcaagccggtgcccccggccaagccggtcgtg
ccgccctcggcgcccggcgcgctgcgcctgcccatcgtcgacgtcacctga

DBGET integrated database retrieval system