KEGG   Thermobispora bispora: Tbis_0628Help
Entry
Tbis_0628         CDS       T01236                                 

Definition
FAD dependent oxidoreductase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
tbi  Thermobispora bispora
Pathway
Steroid degradation
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    Tbis_0628
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     Tbis_0628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
682234..683904
Genome map
AA seq 556 aa AA seqDB search
MDYDVVVVGSGFGGSVAALRLTEKGYSVGVLEAGRRFDEKTLPKTSWRLRDFLWAPALGL
KGIQRIHLLRGESGVLVLAGAGVGGGSLVYANTLYEPLDPFFTDPQWAHITDWKDELAPY
YDQAKRMLGAVVNPSMTPADEVMRKVAERMGVGGTFHLAPVGVFFGEPGVEVDDPYFGGV
GPRRRGCTECGECMTGCRHGAKNMLTKNYLYLAEKAGAKIHPETTVVSVRPITGGYELTV
RRTGVFGRTRTITAGQVVFAAGTYGTQKLLHRLKRTTLPNLSPRLGELTRTNSEALLGFE
RPTTRGPKLNRGVAITSSFHPDAETHIEPVRYGDGSNMMALLRTLLVDGGGRTPRWARFL
GEVARRPHLIPWLFRIRHWSERTVIALVMQAKNNSITVRLRGGRLRAERGHGEPNPTWIP
AGHRAVRIAAEEVGGLPGGTWLDLFNIPATAHFIGGCVIGDSPETGVIDPYHRVYGYEGL
HIVDGSAISANLGVNPSLTITAQAERAMAFWPNKGEPDPRPPLGSPYVRIKPVPPAKPVV
PPSAPGALRLPIVDVT
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggattacgacgtcgtggtcgtcggctcggggttcgggggcagcgtggcggcgctccgg
ctgacggagaaggggtactcggtcggcgtgctggaggcggggcgcaggttcgacgagaag
accctgcccaagacctcctggcgcctgcgggacttcctgtgggcccccgccctggggctg
aaggggatccagcgcatccacctgctgcgcggcgagagcggggtgctggtgctcgccggg
gccggggtcggcgggggctccctggtctacgcgaacacgctctacgagcccctcgacccg
ttcttcaccgacccgcagtgggcgcacatcaccgactggaaggacgagctcgccccctac
tacgaccaggccaagcggatgctcggcgcggtggtcaacccgtccatgaccccggcggac
gaggtcatgcggaaggtcgccgagcggatgggcgtgggcggcaccttccacctcgccccg
gtcggggtgttcttcggcgagcccggggtcgaggtcgacgacccgtacttcggcggggtc
ggcccgcgccgccgcgggtgcaccgagtgcggggagtgcatgaccggctgccgccacggc
gccaagaacatgctcaccaagaactacctctacctggcggagaaggcgggggcgaagatc
cacccggagaccaccgtggtctcggtccggccgatcaccggcgggtacgagctcaccgtg
cgccgcaccggcgtgttcggccgcacccgcacgatcaccgccggccaggtggtcttcgcc
gcgggcacgtacggcacccagaagctgctccaccggctgaagcggacgaccctgccgaac
ctctcgccccggctcggcgagctgacccggaccaactccgaggcgctgctcggcttcgag
cgcccgaccacgagggggccgaagctcaaccgcggcgtggcgatcacctcgtcgttccac
ccggacgcggagacgcacatcgagccggtccggtacggcgacggctccaacatgatggcg
ctgctgcgcacgctcctggtggacgggggcgggcggacgccccgctgggcgcggttcctc
ggcgaggtggcccggcggccgcacctgatcccctggctcttccgcatccgccactggtcg
gagcggaccgtgatcgccctggtcatgcaggcgaagaacaactcgatcacggtgcggctc
cgcgggggccggctccgggccgagcggggccacggcgagccgaaccccacctggatcccg
gccgggcaccgggcggtgcggatcgccgccgaggaggtcggcggcctgcccggcggcacc
tggctcgacctgttcaacatcccggcgaccgcgcacttcatcggcggctgcgtgatcggc
gactccccggagaccggggtgatcgacccctaccaccgggtgtacgggtacgagggcctg
cacatcgtggacggctcggcgatctcggcgaacctgggggtgaacccctcgctcaccatc
accgcccaggccgagcgggccatggcgttctggccgaacaagggcgagcccgacccccgg
ccgccgctcggctcgccgtacgtgcggatcaagccggtgcccccggccaagccggtcgtg
ccgccctcggcgcccggcgcgctgcgcctgcccatcgtcgacgtcacctga

DBGET integrated database retrieval system