KEGG   Thermobispora bispora: Tbis_0654Help
Entry
Tbis_0654         CDS       T01236                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tbi  Thermobispora bispora
Pathway
tbi00020  Citrate cycle (TCA cycle)
tbi00640  Propanoate metabolism
tbi00660  C5-Branched dibasic acid metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01130  Biosynthesis of antibiotics
tbi01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbis_0654
   00640 Propanoate metabolism
    Tbis_0654
   00660 C5-Branched dibasic acid metabolism
    Tbis_0654
Enzymes [BR:tbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Tbis_0654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADG87379
JGI: Tbis_0654
UniProt: D6Y5N3
Position
719224..720405
Genome map
AA seq 393 aa AA seqDB search
MDLFEHQAKELFAEYGIPVPRGIVAHTAEEARAAAETLTGRVVVKAQVKTGGRGKAGGVK
LADGPDDAYEKAQQILGMDIKGHTVRKVLVEEASQIAEEYYFSFLLDRANRTFLSICSAA
GGMDIEEVARQTPEKVAKVPIDPLTGVDRAKAREIAIAGGLPERALDGAVDIIEKLWAVF
VDEDATLVEVNPMILTVDGAVRAIDGKVTLDDNALFRQPDHQKYVDKAAEDPLEARAKEL
DLNYVKLDGSVGIIGNGAGLVMSTLDVVAYAGESFPGQPKPANFLDIGGGASAEVMANGL
QIILSDPSVKSVFVNVFGGITACDAVANGIVSAFKLLESRGEAVTRPLVVRLDGNNAALG
RKILTDAALPGVELVDTMDEAAKRAAELAAVGA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaacatcaggcgaaagaactcttcgcggagtacggcatcccagtacca
cgcggcatcgtcgcgcacacggcggaggaggcgcgcgcggcggccgagacgctgaccggc
cgagtcgttgtcaaggcgcaggtcaagaccgggggccgcggcaaagcgggcggcgtgaag
ctcgccgacggtcccgacgacgcgtacgagaaggcgcagcagattctcggcatggacatc
aagggccacacggtccgcaaggtcctggtcgaggaggcgagccagatcgcggaggagtac
tacttctccttcctgctcgaccgcgcgaaccgcaccttcctctccatctgctcggccgcc
ggcggcatggacatcgaggaggtcgcgcgccagacgcccgagaaggtggccaaggtgccg
atcgacccgctcaccggggtggatcgcgcgaaggcccgggagatcgcgatcgccggcggc
ctgcccgagcgggcgctcgacggcgccgtggacatcatcgagaagctctgggcggtcttc
gtcgacgaggacgccaccctcgtcgaggtgaacccgatgatcctcactgtcgacggcgcg
gtgcgggcgatcgacggcaaggtcaccctcgacgacaacgcgctcttccgccagcccgac
caccagaagtacgtcgacaaggcagcggaggaccccctggaggcccgcgccaaggagctc
gacctcaactacgtcaagctcgacggctcggtcggcatcatcggcaacggcgccggcctg
gtcatgtccacgctcgacgtggtggcgtacgccggggagtccttcccgggccagccgaag
ccggcgaacttcctcgacatcggcggcggcgcctcggccgaggtcatggccaacggcctg
cagatcatcctgtccgacccgtcggtgaagtcggtgttcgtcaacgtcttcggcggcatc
accgcctgcgacgcggtcgccaacgggatcgtctccgcgttcaagctgctggagagccgc
ggtgaggcggtgacccggccgctggtcgtccggctggacggcaacaacgccgccctcggg
cggaagatcctgaccgacgccgcgctgcccggcgtcgagctggtggacaccatggatgaa
gcggccaagcgtgccgccgagctcgccgcggtaggtgcctga

DBGET integrated database retrieval system