KEGG   Thermobispora bispora: Tbis_0682Help
Entry
Tbis_0682         CDS       T01236                                 

Definition
pyrimidine-nucleoside phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tbi  Thermobispora bispora
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tbis_0682
Enzymes [BR:tbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Tbis_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
749193..750479
Genome map
AA seq 428 aa AA seqDB search
MGFDAIEVIVTKRDGGELSTAQIDWVVDAYTRGAVAEEQMAALLMAILLNGMNRREIADW
TKAMIRTGERMDWSALDRPTADKHSTGGVGDKITLPLAPLVAACGAYVPQLSGRGLGHTG
GTLDKLESIPGWRATLSQEEMLQVIRTAGAVVCAAGAGLAPADRKIYALRDVTGTVESIP
LIASSIMSKKIAEGTGSLVLDVKVGSGAFMKDVASARELARTMVDLGLDAGVRTVALLTA
MDRPLGRAVGNALEVAEAVEVLAGGGPSDVVELTVRLAREMLEAAQVPNPKDPEQALKDG
SAMDVWRRMIRAQGGDPDAPLPEANEVTVVSAPATGVLTRLDAYAVGVAAWRLGAGRARK
EDPVSATAGVTLHAKPGDRVTRGQPLLTLHADDPARFERALQVLEGAYTIEENGTPDLLP
LVIERIAG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggggttcgatgcgatcgaggtgatcgtcaccaagcgggacggcggcgagctgtccacc
gcgcagatcgactgggtggtcgacgcatacacgcgcggcgcggtggccgaggagcagatg
gccgcgctgctcatggcgatcctgctcaacggcatgaaccgccgggagatcgcggactgg
accaaggcgatgatccggacgggggagcggatggactggtccgccctcgaccggccgacc
gcggacaagcactccaccggcggggtgggggacaagatcacgctgccgctcgccccgctc
gtggcggcctgcggcgcgtacgtcccccagctctccggccgcgggctcggccacaccggc
ggcacgctcgacaagctcgagtccatccccgggtggcgggccacgctctcccaggaggag
atgctccaggtcatccgcaccgccggcgcggtggtctgcgccgccggcgccgggctggcg
ccggccgaccggaagatctacgcgctccgcgacgtcaccggcacggtcgagtcgatcccg
ctgatcgcctcctcgatcatgtccaagaagatcgccgagggcaccgggtcgctcgtgctc
gacgtcaaggtcggctcgggcgcgttcatgaaggacgtggcgagcgcccgggagctcgcc
cggaccatggtcgacctcggcctggacgcgggcgtgcgcaccgtcgccctgctcaccgcc
atggaccgcccgctcggccgggccgtgggaaacgccctggaggtcgccgaggccgtcgag
gtcctcgccggcggcgggccgtccgacgtggtcgagctcaccgtacggctcgcccgggag
atgctcgaggccgcccaggtgcccaaccccaaggaccccgagcaggccctcaaggacggg
tcggccatggacgtctggcggcgcatgatccgcgcccagggcggcgacccggacgccccg
ctgcccgaggccaacgaggtcaccgtggtcagcgcgcccgccaccggggtgctcacccgc
ctcgacgcctacgcggtcggggtggcggcctggcggctcggggccggccgggcccgcaag
gaggacccggtgtcggcgaccgcgggcgtcaccctccacgccaagccgggcgaccgggtg
acccgcggccagcccctgctcaccctgcacgcggacgacccggcccgcttcgagcgggcg
ctccaggtgctcgagggcgcgtacacgatcgaggagaacggcaccccggacctgctcccg
ctcgtcatcgaacggatcgccggatag

DBGET integrated database retrieval system