KEGG   Thermobispora bispora: Tbis_0783Help
Entry
Tbis_0783         CDS       T01236                                 

Definition
family 3 glycoside hydrolase domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
tbi  Thermobispora bispora
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tbis_0783
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Tbis_0783
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tbis_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
878733..879995
Genome map
AA seq 420 aa AA seqDB search
MAGCSTGAPAPQPPPASAPPSEATPGPGAGQSPSPSPSPSPGGEAAGLLARMSLEDKVGQ
LFMIVVYGPRAGAAHQENTARYGVATPAEVVRRFRPGGVILFPWAGNISTAEQVAALTTG
LRKASPLVPLMVGVDQENGEVARLGSLVTKLPGAPAIGRTRDPRLARDVARVTGEELRDL
GIAVDFAPVADVSAKGSFIRSRAYGSDPKLVSAMVRAAVEGFHAAGVASVAKHFPGHGGT
SVDSHQDLPVITYSKARWRRVDAPPFRAAIERGVDAIMTAHVAMPRLDPSGDPATLSRAV
ITGLLRGELGYDGVVVTDALDMAGVRKRYGDAEVAVRAILAGADLLLMPPDLPTAYQAVL
TAVRSGRIPERRIDESVLRILRLKERRGVLGPTRTDPGGVKSAEHLKVARRVAAAIADAR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtggccggctgctcgaccggtgctcccgcgccgcagccgccgcccgcgtccgctccgccg
tccgaggcgacgcccggcccgggcgcggggcagagcccgtcgcccagcccttcgccctcg
cccggcggcgaggccgcagggctgctcgcgcggatgagcctcgaggacaaggtcggccag
ctcttcatgatcgtcgtgtacggcccgcgggccggcgcggcccaccaggagaacaccgcc
cggtacggcgtggccaccccggccgaggtggtgcgcaggttccgccccggcggagtgatc
ctcttcccgtgggcgggcaacatctccaccgccgagcaggtcgccgcgctcaccaccggg
ctccggaaggcgtcccccctggtgccgctcatggtcggcgtcgaccaggagaacggcgag
gtggcgcggctggggtcgctggtgaccaagctgccgggcgccccggcgatcgggcggacc
cgcgatccgcggctcgcgcgggacgtggcgcgggtgaccggtgaggagctgcgcgacctg
gggatcgcggtggacttcgcgccggtcgccgacgtcagcgccaaggggtcgttcatccgg
tcgcgggcctacgggtccgatccgaagctcgtctcggccatggtgcgggcggccgtggag
gggttccacgccgccggcgtcgcctcggtcgccaagcacttccccgggcacggcggcacc
agcgtggacagccaccaggacctgccggtcatcacgtactccaaggcccggtggcggcgc
gtggacgcgccgccgttccgggcggcgatcgagcgcggcgtggacgcgatcatgaccgcg
cacgtggccatgccgaggctcgacccctccggcgaccccgccacgctctcccgcgcggtg
atcaccggcctgctccgcggggagctcgggtacgacggggtggtcgtcaccgacgcgctc
gacatggccggggtgcgcaagcggtacggcgacgccgaggtggcggtgcgggcgatcctc
gccggcgcggatctgctcctcatgccgcccgacctgcccaccgcgtaccaggcggtgctg
accgcggtgcggtccggccgcatccccgaacggcggatcgacgagtcggtgctccgcatc
ctccggctgaaggagcggcgcggcgtcctcgggcccacccgcaccgatccgggcggggtg
aagtcggccgagcacctcaaggtggcgcggcgggtggcggcggccatcgccgacgccagg
tag

DBGET integrated database retrieval system