KEGG   Thermobispora bispora: Tbis_0884Help
Entry
Tbis_0884         CDS       T01236                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tbi  Thermobispora bispora
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbis_0884
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_0884
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tbis_0884
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tbis_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1009437..1010495
Genome map
AA seq 352 aa AA seqDB search
MHRAWRGVIEEYRDRLPVSPATPVVTLLEGGTPLLPAKRLSELTGCEVYLKVEGLNPTGS
FKDRGMTVAISKAVEEGAKAVICASTGNTSASAAAYAVRAGLTCAVLVPRGKIAMGKLAQ
ALVHGARLIQVEGSFDDCLELTRRLAEEYPIALVNSINPHRLQGQKTAAFEIVDVLGDAP
DVHCIPVGNAGNISAYWMGYTEYADDGLAKKRPRMLGFQASGAAPLVKGEPVAKPQTIAT
AIRIGNPASWRLAEAARDESGGDIQAVTDRQIAAAYKLLAQEEGVFVELASAASVAGLLQ
AHERGLVAPGERVVCTVTGNGLKDPDWAIAGAPAPTTIPVDAHAAAAALELA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcacagggcgtggcgcggcgtcatcgaggagtaccgagaccgtctcccggtctccccg
gcgacgcccgtggtgaccctgctcgagggcggtacgccgctcctcccggccaagcgcctc
tccgagctcaccggctgcgaggtctacctcaaggtcgaagggctcaaccccaccgggagc
ttcaaggatcgcgggatgaccgtcgccatcagcaaggcggtcgaggagggcgcgaaggcc
gtgatctgcgcttccaccgggaacactagcgcatcggccgccgcttacgcggtacgcgcc
ggtctcacctgcgcggtgctcgtgccccgcggcaagatcgcgatgggcaagctggcgcag
gccctggtgcacggcgcgcggctgatccaggtcgagggatcgttcgacgactgcctcgag
ctgaccaggaggctcgccgaggagtacccgatcgcgctggtcaactcgatcaacccccat
cgcctccaggggcagaagaccgcggcgttcgagatcgtcgacgtgctcggcgacgccccg
gacgtgcactgcatcccggtgggcaacgccggcaacatctcggcctactggatgggctac
accgagtacgctgacgatggcctggcgaagaagcggccgcggatgctcgggttccaggcg
agcggggccgcgcccctggtgaagggggaaccggtcgccaagccgcagacgatcgccacg
gcgatcaggatcgggaacccggcgtcgtggcggctcgccgaggccgcgcgggacgagtcg
ggcggcgacatccaggccgtcaccgaccgtcagatcgcggccgcctacaagctgctcgcg
caggaggagggagtgttcgtcgagctcgcctcggccgcgagcgtggccggactgctccag
gcccacgagcgagggctggtcgcgccgggggagcgcgtggtgtgcacggtgaccggcaac
gggctcaaggaccccgactgggcgatcgcgggcgcgccggcgcccaccacgatccccgtc
gacgcccacgccgcggcagccgcgctcgagctcgcctga

DBGET integrated database retrieval system