KEGG   Thermobispora bispora: Tbis_0884Help
Entry
Tbis_0884         CDS       T01236                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi00260  Glycine, serine and threonine metabolism
tbi00750  Vitamin B6 metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01230  Biosynthesis of amino acids
Module
tbi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_0884
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tbis_0884
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tbis_0884
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG87608
JGI: Tbis_0884
UniProt: D6Y713
Position
1009437..1010495
Genome map
AA seq 352 aa AA seqDB search
MHRAWRGVIEEYRDRLPVSPATPVVTLLEGGTPLLPAKRLSELTGCEVYLKVEGLNPTGS
FKDRGMTVAISKAVEEGAKAVICASTGNTSASAAAYAVRAGLTCAVLVPRGKIAMGKLAQ
ALVHGARLIQVEGSFDDCLELTRRLAEEYPIALVNSINPHRLQGQKTAAFEIVDVLGDAP
DVHCIPVGNAGNISAYWMGYTEYADDGLAKKRPRMLGFQASGAAPLVKGEPVAKPQTIAT
AIRIGNPASWRLAEAARDESGGDIQAVTDRQIAAAYKLLAQEEGVFVELASAASVAGLLQ
AHERGLVAPGERVVCTVTGNGLKDPDWAIAGAPAPTTIPVDAHAAAAALELA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcacagggcgtggcgcggcgtcatcgaggagtaccgagaccgtctcccggtctccccg
gcgacgcccgtggtgaccctgctcgagggcggtacgccgctcctcccggccaagcgcctc
tccgagctcaccggctgcgaggtctacctcaaggtcgaagggctcaaccccaccgggagc
ttcaaggatcgcgggatgaccgtcgccatcagcaaggcggtcgaggagggcgcgaaggcc
gtgatctgcgcttccaccgggaacactagcgcatcggccgccgcttacgcggtacgcgcc
ggtctcacctgcgcggtgctcgtgccccgcggcaagatcgcgatgggcaagctggcgcag
gccctggtgcacggcgcgcggctgatccaggtcgagggatcgttcgacgactgcctcgag
ctgaccaggaggctcgccgaggagtacccgatcgcgctggtcaactcgatcaacccccat
cgcctccaggggcagaagaccgcggcgttcgagatcgtcgacgtgctcggcgacgccccg
gacgtgcactgcatcccggtgggcaacgccggcaacatctcggcctactggatgggctac
accgagtacgctgacgatggcctggcgaagaagcggccgcggatgctcgggttccaggcg
agcggggccgcgcccctggtgaagggggaaccggtcgccaagccgcagacgatcgccacg
gcgatcaggatcgggaacccggcgtcgtggcggctcgccgaggccgcgcgggacgagtcg
ggcggcgacatccaggccgtcaccgaccgtcagatcgcggccgcctacaagctgctcgcg
caggaggagggagtgttcgtcgagctcgcctcggccgcgagcgtggccggactgctccag
gcccacgagcgagggctggtcgcgccgggggagcgcgtggtgtgcacggtgaccggcaac
gggctcaaggaccccgactgggcgatcgcgggcgcgccggcgcccaccacgatccccgtc
gacgcccacgccgcggcagccgcgctcgagctcgcctga

DBGET integrated database retrieval system