KEGG   Thermobispora bispora: Tbis_0932Help
Entry
Tbis_0932         CDS       T01236                                 

Definition
isochorismatase hydrolase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
tbi  Thermobispora bispora
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Tbis_0932
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Tbis_0932
    3.5.1.-  
     Tbis_0932
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1057736..1058308)
Genome map
AA seq 190 aa AA seqDB search
MTTALVIVDVQNDFCEGGSLAVAGGAEVAAAITRHLRDNRYDHVVATRDYHIDPGSHFSD
EPDYVTSWPAHCVADTPGAAFHPALDTSAVEEVFSKGAHSAAYSGFEGAAPDGTGLAEWL
RARGVDAIDVVGIATDHCVRATALDGARSGFSVRVLLGLTAGVARETTDRALAELKEAGV
ELVGTPIVRS
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccgcgctcgtcatcgtcgacgtgcagaacgacttctgcgagggtggcagcctc
gccgtcgccggaggcgccgaggtcgccgccgcgatcacccgtcacctccgggacaaccga
tacgaccacgtggtcgccacccgggactaccacatcgacccgggctcccacttctccgac
gagcccgactacgtgacgagctggccggcgcactgcgtggcggacaccccgggcgccgcc
ttccaccccgccctggacacctcggcggtcgaggaggtgttcagcaagggcgcccactcg
gccgcgtacagcgggttcgagggggcggccccggacggcaccggcctggccgagtggctg
cgggcgcgcggggtggacgcgatcgacgtggtcggcatcgccaccgaccactgcgtgcgc
gccaccgccctggacggcgcccggtccggcttcagcgtgcgggtcctcctcggcctcacc
gccggcgtcgcccgggagaccaccgaccgcgccctcgccgagctcaaggaggcgggcgtc
gagctcgtcgggaccccgatcgtccggagctga

DBGET integrated database retrieval system