KEGG   Thermobispora bispora: Tbis_1006Help
Entry
Tbis_1006         CDS       T01236                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tbi  Thermobispora bispora
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tbis_1006
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Tbis_1006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1133661..1134608
Genome map
AA seq 315 aa AA seqDB search
MTEPRGPVDASRVPRFAGPATFARLPRLDEVSRADVAVVGIPFDSGVSYRPGARFGPAAV
REASRLLRPYHPGLDVSPFARLQVADAGDIACNPFDIKEAIATIEAAAQDLSAPGTRLVT
IGGDHTIALPLLRVVHRLHGPVALLHFDAHLDTWDTYFGAEYTHGTPFRRAIEEGLLDTE
AISHVGTRGPLYGKQDLDDDARMGFGIVTSADVMRRGPDEVAAMLRERIGDRPLYISIDI
DVLDPAHAPGTGTPEAGGLTSRELLEILRGLAGCNLVGADVVEVAPAYDHAEITSIAASH
VAYDLISLLALKEKP
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagccccgaggccctgtcgacgcctctcgcgtcccgcggttcgccgggccggcg
accttcgcccggctgccccgcctcgacgaggtgagccgcgcggacgtggccgtggtcggg
atcccgttcgacagcggcgtgtcctaccggccgggtgcgcggttcggcccggcggccgtg
cgcgaggcgagccggctgctgcggccgtaccacccgggactcgacgtgtcgccgttcgcc
cgcctgcaggtggccgacgccggggacatcgcgtgcaacccgttcgacatcaaggaggcg
atcgcgaccatcgaggcggccgcgcaggacctgtccgcgccggggacccggctggtcacg
atcggcggcgaccacacgatcgcgctgcccctgctgcgggtcgtccaccgcctccacggc
ccggtggcgctgctgcacttcgacgcccacctcgacacctgggacacctacttcggcgcg
gagtacacccacggcaccccgttccgccgggcgatcgaggagggcctgctcgacaccgag
gcgatcagccacgtcggcacccgcggcccgctctacggcaagcaggacctcgacgacgac
gcgcgcatggggttcggcatcgtgacgagcgccgacgtcatgcgccgcgggccggacgag
gtggccgcgatgctccgggagcggatcggcgaccggccgctgtacatctccatcgacatc
gacgtgctcgacccggcgcacgcgccgggcaccgggaccccggaggccggcgggctcacc
agcagggagctgctggagatcctgcgcgggctggccgggtgcaacctggtgggcgccgac
gtggtcgaggtcgcgcccgcctacgaccacgcggagatcacctcgatcgcggcctcgcac
gtcgcctacgacctgatcagcctgctcgcgctgaaggagaagccatag

DBGET integrated database retrieval system