KEGG   Thermobispora bispora: Tbis_1039Help
Entry
Tbis_1039         CDS       T01236                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tbi  Thermobispora bispora
Pathway
tbi00900  Terpenoid backbone biosynthesis
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tbis_1039
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Tbis_1039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C PHP
Motif
Other DBs
NCBI-ProteinID: ADG87761
JGI: Tbis_1039
UniProt: D6Y7U2
Position
1176697..1177926
Genome map
AA seq 409 aa AA seqDB search
MRIGENGSVLSETSPPAESRAEPRSIVVLGSTGSIGTQALDVIARAPDRFRVVALAAGGG
RVELLARQAAEFGVAAVAVADPGAVPALREALAARGARPKILAGMEGVAELAAHPCDVVL
NGITGALGLTSTIAALEAGRTLALANKESLIIGGPLVKRLAGPGRLIPVDSEHSALAQCL
WAAGPSGADPRAVRRLVITASGGPFRGRTRAELEDVTPEMALNHPTWNMGPVITVNSATL
VNKGLEVIEAHLLFDIGFDRIEVMIHPQSVIHSMVEFVDGSTIAQASPPDMRLPISLALG
FPERVPGAAPAVDWTRAHTWTFEPLDDETFPAVALARHVGELGGTAPAVYNAANEVCVEA
FLKGRLPFLGIVDTVGKVVAEHTVGPADSVEEVLAADAWARERAAELAG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggggagaatgggagcgtgctgtccgaaaccagcccgccggcggagtcccgc
gccgagccccgctcgatcgtcgtgctgggatcgaccggctccatcggcacccaggccctc
gacgtcatcgcacgcgcccccgaccggttccgcgtggtcgcgctcgccgctggcggcggg
cgggtcgagctgctggcgcgccaggccgccgagttcggggtggccgcggtcgccgtcgcg
gacccgggggcggtcccggcgctgcgggaggcgctcgccgcgcggggcgcgcggccgaag
atcctcgccggcatggagggcgtcgccgagctcgccgcccacccgtgcgacgtcgtgctc
aacggcatcaccggcgcgctcgggctcacctccacgatcgccgcgctcgaggccgggcgg
acgctggcgctcgcgaacaaggagtccttgatcatcggcggcccgctggtgaagcgcctc
gccgggccgggacggctgatccccgtcgactcggagcactccgcgctcgcccagtgcctc
tgggcggccgggccctcgggcgcggacccgcgcgccgtgcgccggctggtgatcacggcg
agcggcgggccgttccgggggaggaccagggccgagctcgaggacgtgacgccggagatg
gcgctcaatcacccgacgtggaacatgggcccggtgatcaccgtcaactcggccaccctg
gtcaacaagggcctcgaggtgatcgaggcgcacctgctcttcgacatcggcttcgaccgc
atcgaggtgatgatccacccgcagtcggtgatccactcgatggtcgagttcgtcgacggc
tccaccatcgcccaggcgagcccgccggacatgcggctgccgatctccctcgccctgggc
ttccccgagcgcgtccccggcgcggcgccggccgtcgactggacccgggcgcacacctgg
acgttcgagccgctcgacgacgagacgttcccggccgtcgcgctcgcccggcacgtcggc
gagctcggcggcacggccccggccgtctacaacgcggcgaacgaggtgtgcgtcgaggcc
ttcctcaagggcaggctgccgttcctcggcatcgtcgacacggtcggcaaggtggtggcc
gagcacaccgtgggcccggccgattcggtggaggaggtgctcgccgccgacgcctgggcg
cgggagcgggcggccgagctggccggctga

DBGET integrated database retrieval system