KEGG   Thermobispora bispora: Tbis_1039Help
Entry
Tbis_1039         CDS       T01236                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tbi  Thermobispora bispora
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:tbi00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1176697..1177926
Genome map
AA seq 409 aa AA seqDB search
MRIGENGSVLSETSPPAESRAEPRSIVVLGSTGSIGTQALDVIARAPDRFRVVALAAGGG
RVELLARQAAEFGVAAVAVADPGAVPALREALAARGARPKILAGMEGVAELAAHPCDVVL
NGITGALGLTSTIAALEAGRTLALANKESLIIGGPLVKRLAGPGRLIPVDSEHSALAQCL
WAAGPSGADPRAVRRLVITASGGPFRGRTRAELEDVTPEMALNHPTWNMGPVITVNSATL
VNKGLEVIEAHLLFDIGFDRIEVMIHPQSVIHSMVEFVDGSTIAQASPPDMRLPISLALG
FPERVPGAAPAVDWTRAHTWTFEPLDDETFPAVALARHVGELGGTAPAVYNAANEVCVEA
FLKGRLPFLGIVDTVGKVVAEHTVGPADSVEEVLAADAWARERAAELAG
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggggagaatgggagcgtgctgtccgaaaccagcccgccggcggagtcccgc
gccgagccccgctcgatcgtcgtgctgggatcgaccggctccatcggcacccaggccctc
gacgtcatcgcacgcgcccccgaccggttccgcgtggtcgcgctcgccgctggcggcggg
cgggtcgagctgctggcgcgccaggccgccgagttcggggtggccgcggtcgccgtcgcg
gacccgggggcggtcccggcgctgcgggaggcgctcgccgcgcggggcgcgcggccgaag
atcctcgccggcatggagggcgtcgccgagctcgccgcccacccgtgcgacgtcgtgctc
aacggcatcaccggcgcgctcgggctcacctccacgatcgccgcgctcgaggccgggcgg
acgctggcgctcgcgaacaaggagtccttgatcatcggcggcccgctggtgaagcgcctc
gccgggccgggacggctgatccccgtcgactcggagcactccgcgctcgcccagtgcctc
tgggcggccgggccctcgggcgcggacccgcgcgccgtgcgccggctggtgatcacggcg
agcggcgggccgttccgggggaggaccagggccgagctcgaggacgtgacgccggagatg
gcgctcaatcacccgacgtggaacatgggcccggtgatcaccgtcaactcggccaccctg
gtcaacaagggcctcgaggtgatcgaggcgcacctgctcttcgacatcggcttcgaccgc
atcgaggtgatgatccacccgcagtcggtgatccactcgatggtcgagttcgtcgacggc
tccaccatcgcccaggcgagcccgccggacatgcggctgccgatctccctcgccctgggc
ttccccgagcgcgtccccggcgcggcgccggccgtcgactggacccgggcgcacacctgg
acgttcgagccgctcgacgacgagacgttcccggccgtcgcgctcgcccggcacgtcggc
gagctcggcggcacggccccggccgtctacaacgcggcgaacgaggtgtgcgtcgaggcc
ttcctcaagggcaggctgccgttcctcggcatcgtcgacacggtcggcaaggtggtggcc
gagcacaccgtgggcccggccgattcggtggaggaggtgctcgccgccgacgcctgggcg
cgggagcgggcggccgagctggccggctga

DBGET integrated database retrieval system