KEGG   Thermobispora bispora: Tbis_1269Help
Entry
Tbis_1269         CDS       T01236                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tbi  Thermobispora bispora
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbis_1269
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tbis_1269
  Amino acid metabolism
   00310 Lysine degradation
    Tbis_1269
Enzymes [BR:tbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tbis_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1441317..1442792)
Genome map
AA seq 491 aa AA seqDB search
MPVSVTMPQLGESVTEGTVTRWLKKEGDRVEADEPLLEVSTDKVDTEIPSPASGYLTKIL
VREDETVEVGTELAVIDPAGPGAAATEAATAAPEAAPAPAPAPEPAPAPAPPPQPVSSIP
QPAPAAPTPPPAPPTPPPAPAPAPAPAPAPAAQAPQAPPTATGAPTTQPAGETPYVTPLV
RKLAAEHGVDLTKLTGTGVGGRIRKQDVLEAARKQREERERLQREAAQAAPAQAPAQAPV
APAPEPVQVDTTLRGKTEKMSRLRKVIADRMMESLQTSAQLTTVVEVDVTRIAKLRERAK
AAFEAREGVKLTFLPFFALAAVEALKIHPKLNAVINDETNEVTYHDVENLGIAVDTERGL
IVPVIKNAGDLNLAGLARKIADLAERTRTNRITPDELTGGTFTITNTGSRGALFDTPILN
KPQVGMLGTGVVVKRPVVVDSPDGEVIAIRSMVYLSLTYDHRLVDGADAARFLTTIKRRL
EEGRFEGQLGL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgccggtctccgtaacaatgccccagctcggcgagagcgtgaccgagggcaccgtaacc
cgctggctgaagaaggaaggcgatcgcgtcgaagccgacgagccgctcctcgaggtatcg
accgacaaggtcgacaccgagattccttcgccggcctccggctacctgaccaagatcctc
gtccgggaggacgagacggtcgaggtcggcaccgagctcgccgtgatcgacccggcgggc
ccgggtgcggccgccaccgaggcggcgaccgccgcccccgaggccgcgcccgccccggct
ccggcgccggagcccgctccggccccggcaccgccgccgcagcccgtctcgtcgatcccg
cagccggcgcccgccgcgcccacgccgcctcccgctccgcccacgccgccgccggctccc
gcgcccgcgccggccccggctcccgcgcccgctgctcaggcgccgcaggccccgcccacg
gcgaccggcgcgcccaccacgcagccggccggtgagacgccgtacgtcaccccgctcgtg
cgcaagctcgccgccgagcacggggtcgacctcaccaagctgaccggtaccggtgtcggc
ggccgcatccgcaagcaggacgtgctcgaggccgcgcggaagcagcgtgaggagcgcgag
cggctgcagcgcgaggccgcgcaggccgccccggcccaggcgcccgcgcaggcccccgtg
gccccggcccccgagccggtgcaggtcgacacgaccctgcgcggcaagaccgagaagatg
tcgcggctgcgcaaggtgatcgccgaccgcatgatggagtcgctgcagacctccgcgcag
ctcaccacggtggtcgaggtcgacgtcacccgcatcgccaagctccgcgagcgggccaag
gccgcgttcgaggcgcgggagggcgtgaagctcaccttcctgccgttcttcgcgctcgcc
gccgtcgaggcactcaagatccacccgaagctcaacgcggtcatcaacgacgagaccaac
gaggtgacgtaccacgacgtcgagaacctcggcatcgcggtcgacaccgagcgcggtctc
atcgtcccggtgatcaagaacgcgggcgacctcaacctcgccggcctcgcccggaagatc
gccgacctcgccgagcgcacccggaccaaccggatcacgcccgacgagctcaccggcggc
acgttcacgatcaccaacaccggcagccgcggcgcgctgttcgacacgccgatcctcaac
aagccgcaggtcggcatgctcggcaccggcgtggtggtcaagcgcccggtggtggtggac
tcgccggacggcgaggtcatcgccatccgctcgatggtctacctgtcgctcacctacgac
caccggctggtcgacggcgccgacgccgcgcgcttcctcaccacgatcaagcgccggctc
gaagagggccgcttcgaggggcagctcggcctctga

DBGET integrated database retrieval system