KEGG   Thermobispora bispora: Tbis_1308Help
Entry
Tbis_1308         CDS       T01236                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tbi  Thermobispora bispora
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbis_1308
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_1308
   00052 Galactose metabolism
    Tbis_1308
   00500 Starch and sucrose metabolism
    Tbis_1308
   00520 Amino sugar and nucleotide sugar metabolism
    Tbis_1308
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tbis_1308
   00524 Butirosin and neomycin biosynthesis
    Tbis_1308
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tbis_1308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1483591..1484532
Genome map
AA seq 313 aa AA seqDB search
MALTIGVDVGGTKIAAGVVDHEGRILDRTHRQTPAGNPEKVSLTIADAVSELAARHPVDA
VGIGAAGFVDETRSVIRFAPNLAWREEPLREKIADLVGLPVFVENDANAMAWGEYRFGAG
RGESHVVCVTLGTGLGGGIVLDGGLYRGRWGMGGELGHVQVQPGGRPCGCGNLGCWERYA
SGTALLAEARRNLEADPSSGSVLLRLAGSVDGIRGEHVTAAAREGDPAALAAFHTMAEWL
AQGFADLAATLDPGCFIVGGGVSEAADLFIDKVRSEFADRLVGRGHRPLAEIRVAELGPA
AGVVGAADLARQR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgaccatcggcgtggacgtgggcggtaccaagatcgccgcgggtgtcgtcgac
cacgaggggaggatcctggaccggacgcaccggcagacccccgccggcaacccggagaag
gtctccctgaccatcgccgacgcggtctccgagctggccgcccgccatcccgtcgatgcg
gtcggcatcggcgcggcggggttcgtggacgagacccggtcggtcatccggttcgccccc
aacctcgcctggcgcgaggagccgctgcgcgagaagatcgctgacctggtcggcctgccg
gtgttcgtggagaacgacgccaacgccatggcctggggggagtaccgcttcggggccggg
cgcggcgagagccacgtggtctgcgtgaccctcggcaccgggctgggcggcgggatcgtg
ctcgacggcgggctctaccggggccggtggggcatgggcggtgagctcgggcacgttcag
gtgcagccgggcggccgcccgtgcgggtgcgggaacctcgggtgctgggagcggtacgcg
agcgggaccgcgctgctcgccgaggcgcggcggaacctggaggccgatccctcgtcgggg
tccgtgctgctccgcctcgccggatccgtggacggcatccggggcgagcacgtgaccgcg
gcggcgcgggagggcgacccggcggccctcgcggccttccacactatggcggagtggctc
gcccagggcttcgccgacctcgcggccaccctcgacccggggtgcttcatcgtcggcggc
ggcgtctccgaggccgccgacctgttcatcgacaaggtcaggtccgagttcgccgaccgg
ctcgtcggccgcggccaccgcccgctcgccgagatcagggtggccgagctcggaccggcg
gccggggtggtcggggcggccgatctcgcccggcagcgctga

DBGET integrated database retrieval system