KEGG   Thermobispora bispora: Tbis_1325Help
Entry
Tbis_1325         CDS       T01236                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tbi  Thermobispora bispora
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tbis_1325
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tbis_1325
Exosome [BR:tbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tbis_1325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1501114..1502568)
Genome map
AA seq 484 aa AA seqDB search
MSVLAIDAGTSGITALVVTEDGRIDGRGHREFPQHFPEQGWVEHDPEEIWRATLEACRAA
LESSATVPRCVGITNQRETAVLWDRRTLAAPRRAIVWQDRRSAEICARLREHEPRVAELT
GLRLDPYFTATKLTWLAENEPGVWRDGDVMIGTVDSYLIARLTGGARHVTDASNASRTLL
YDIRAGRWSEELCELFGVSGKALPEVVPNFGEIGRTDPEAFLGLELPISGMAGDQQAALF
GQLCLSPGDIKCTYGTGSFILVNTGSEIIRSKAGLLSTVAWQAPSGELTYALEGSIFVTG
AAVQWLRDGLGLIDTAAESERLAREVPDSGGVVFAPALTGLGAPYWAPDARGAILGITRG
TRAAHLARATLEAIAFKVRDIVEAIRAEGLATPVLKVDGGASANDLLMQLQADQLGTPVE
RPVIQETTALGAAFLAGLGAGVWSSPDELRATWRLDRRFEPRYDDGTAYARWKRAVELVV
GWTG
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgtccttgccatcgacgccggtacgtcggggatcaccgccctcgtggtgaccgag
gacgggcggatcgacggccgtggccaccgggagttcccccagcacttccccgaacagggc
tgggtggagcacgaccccgaggagatctggcgggcgacgctggaggcctgccgcgccgcc
ctggagtcgtcggccacggtaccgcggtgcgtcgggatcaccaaccagcgggagaccgcc
gtgctgtgggaccggcggaccctggccgcgccccggcgggccatcgtctggcaggaccgg
cgctcggcggagatctgcgcccggctgcgggagcacgagccccgggtggccgagctcacc
ggcctcaggctcgacccctacttcaccgcgaccaagctcacctggctcgccgagaacgag
cccggcgtctggcgcgacggcgacgtgatgatcggcaccgtggactcgtacctgatcgcc
cggctcaccggcggggcgcggcacgtcaccgacgcgtcgaacgcctcccggaccctgctg
tacgacatccgggccgggcgctggtcggaggagctctgcgagctgttcggcgtctccggg
aaggcgctccccgaggtggtgccgaacttcggggagatcggccgcaccgacccggaggcg
ttcctcggcctcgagctcccgatcagcgggatggccggcgaccagcaggcggcgctcttc
ggccagctgtgcctctcccccggcgacatcaagtgcacgtacggcacgggctcgttcatc
ctcgtcaacaccgggagcgagatcatccggtcgaaggccgggctgctctccaccgtcgcc
tggcaggcgccgtccggcgagctcacctacgcgctggagggctcgatcttcgtcacgggc
gccgccgtgcagtggctgcgcgacggcctcggcctgatcgacacggcggccgagtccgag
cgcctggcgcgggaggtccccgactcgggcggggtggtgttcgcccccgccctgaccggg
ctcggcgcgccgtactgggccccggacgcgcggggcgcgatcctcggcatcacccgcggc
acccgggccgcgcacctggcccgggccaccctggaggcgatcgcgttcaaggtgcgcgac
atcgtcgaggcgatccgggccgaagggctcgccacgccggtgctcaaggtcgacggcggc
gcgagcgccaacgacctgctcatgcagctccaggccgatcagctcggcacgccggtggag
cggccggtgatccaggagacgaccgcgctcggcgccgcgttcctcgccgggctgggggcg
ggcgtgtggtcctcccccgacgagctgcgcgccacctggcggctcgaccgccgcttcgag
ccgcggtacgacgacggcacggcgtacgcccggtggaagcgggccgtggagctggtggtg
ggctggaccggctga

DBGET integrated database retrieval system