KEGG   Thermobispora bispora: Tbis_1326Help
Entry
Tbis_1326         CDS       T01236                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbi  Thermobispora bispora
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:tbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tbi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tbi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tbi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tbi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:tbi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1502761..1503786
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGISVYGYEFVGFRDGWRGPLECDTMPLDIQAVRGI
LPRGGTILGTSRTNPLKLEDGVERIKQNFEKLGVDALIAIGGEDTLGVAKKLHDQGVKVV
GVPKTIDNDLNATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAAGANVILIPEKPFDIDKVCEYVESRFKTRYAPIIVVAEGAHPKEGQLAVQSSELDAF
GHVRLGGIGEALAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRVLATRFGLGAIDAVHDG
DWGKMVALRGTDIVRVSLEEATAELKLVPIHRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggagtgctgaccggtggcggtgactgccccgggctcaacgcggtgatccgc
gccgtcgtccgcaagggcatcagcgtgtacggctacgagttcgtcggcttccgggacggc
tggcggggtccgctcgagtgcgacaccatgccgctcgacatccaggccgtccggggcatc
ctcccgcgcggcggcaccatcctcggcacctcgcgcaccaacccgctgaagctcgaggac
ggtgtggagcgcatcaagcagaacttcgagaagctgggcgtcgacgcgctgatcgccatc
ggcggcgaggacacgctcggcgtcgccaagaagctccacgaccagggcgtcaaggtcgtc
ggcgtgccgaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
accgcggtcaacatcgcgatggaggcgatcgaccggctccacaccacggccgagtcgcac
caccgcgccctgatctgcgaggtcatgggccgccacgccgggtggatcgccctgcacgcg
ggcatggccgccggggcgaacgtcatcctcatcccggagaagccgttcgacatcgacaag
gtctgcgagtacgtcgagtcccggttcaagacccgctacgcgccgatcatcgtggtcgcc
gagggcgcccacccgaaggagggccagctcgccgtccagagctcggagctggacgcgttc
ggccacgtccgcctcggcggcatcggtgaggcgctcgccaaggagatcgagaagcggacc
ggcaaggaggcgcggaccacggtcctcggccacatccagcgcggtggcacgcccacggcc
ttcgaccgggtgctcgccacccggttcggtctcggcgccatcgacgcggtccacgacggc
gactggggcaagatggtcgcgctccgcggcacggacatcgtccgggtgagcctcgaggag
gccaccgccgagctgaagctggtgccgatccaccgctacgaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system