KEGG   Thermobispora bispora: Tbis_1326Help
Entry
Tbis_1326         CDS       T01236                                 

Definition
(GenBank) phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
tbi  Thermobispora bispora
Pathway
tbi00010  Glycolysis / Gluconeogenesis
tbi00030  Pentose phosphate pathway
tbi00051  Fructose and mannose metabolism
tbi00052  Galactose metabolism
tbi00680  Methane metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_1326
   00030 Pentose phosphate pathway
    Tbis_1326
   00051 Fructose and mannose metabolism
    Tbis_1326
   00052 Galactose metabolism
    Tbis_1326
  Energy metabolism
   00680 Methane metabolism
    Tbis_1326
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tbis_1326
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Tbis_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-ProteinID: ADG88044
JGI: Tbis_1326
UniProt: D6Y9C4
Position
1502761..1503786
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGISVYGYEFVGFRDGWRGPLECDTMPLDIQAVRGI
LPRGGTILGTSRTNPLKLEDGVERIKQNFEKLGVDALIAIGGEDTLGVAKKLHDQGVKVV
GVPKTIDNDLNATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAAGANVILIPEKPFDIDKVCEYVESRFKTRYAPIIVVAEGAHPKEGQLAVQSSELDAF
GHVRLGGIGEALAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRVLATRFGLGAIDAVHDG
DWGKMVALRGTDIVRVSLEEATAELKLVPIHRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggagtgctgaccggtggcggtgactgccccgggctcaacgcggtgatccgc
gccgtcgtccgcaagggcatcagcgtgtacggctacgagttcgtcggcttccgggacggc
tggcggggtccgctcgagtgcgacaccatgccgctcgacatccaggccgtccggggcatc
ctcccgcgcggcggcaccatcctcggcacctcgcgcaccaacccgctgaagctcgaggac
ggtgtggagcgcatcaagcagaacttcgagaagctgggcgtcgacgcgctgatcgccatc
ggcggcgaggacacgctcggcgtcgccaagaagctccacgaccagggcgtcaaggtcgtc
ggcgtgccgaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
accgcggtcaacatcgcgatggaggcgatcgaccggctccacaccacggccgagtcgcac
caccgcgccctgatctgcgaggtcatgggccgccacgccgggtggatcgccctgcacgcg
ggcatggccgccggggcgaacgtcatcctcatcccggagaagccgttcgacatcgacaag
gtctgcgagtacgtcgagtcccggttcaagacccgctacgcgccgatcatcgtggtcgcc
gagggcgcccacccgaaggagggccagctcgccgtccagagctcggagctggacgcgttc
ggccacgtccgcctcggcggcatcggtgaggcgctcgccaaggagatcgagaagcggacc
ggcaaggaggcgcggaccacggtcctcggccacatccagcgcggtggcacgcccacggcc
ttcgaccgggtgctcgccacccggttcggtctcggcgccatcgacgcggtccacgacggc
gactggggcaagatggtcgcgctccgcggcacggacatcgtccgggtgagcctcgaggag
gccaccgccgagctgaagctggtgccgatccaccgctacgaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system