KEGG   Thermobispora bispora: Tbis_1326Help
Entry
Tbis_1326         CDS       T01236                                 

Definition
phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tbi  Thermobispora bispora
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbis_1326
   01230 Biosynthesis of amino acids
    Tbis_1326
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_1326
   00030 Pentose phosphate pathway
    Tbis_1326
   00051 Fructose and mannose metabolism
    Tbis_1326
   00052 Galactose metabolism
    Tbis_1326
  Energy metabolism
   00680 Methane metabolism
    Tbis_1326
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Tbis_1326
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tbis_1326
Protein phosphatases and associated proteins [BR:tbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Tbis_1326
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1502761..1503786
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTGGGDCPGLNAVIRAVVRKGISVYGYEFVGFRDGWRGPLECDTMPLDIQAVRGI
LPRGGTILGTSRTNPLKLEDGVERIKQNFEKLGVDALIAIGGEDTLGVAKKLHDQGVKVV
GVPKTIDNDLNATDYTFGFDTAVNIAMEAIDRLHTTAESHHRALICEVMGRHAGWIALHA
GMAAGANVILIPEKPFDIDKVCEYVESRFKTRYAPIIVVAEGAHPKEGQLAVQSSELDAF
GHVRLGGIGEALAKEIEKRTGKEARTTVLGHIQRGGTPTAFDRVLATRFGLGAIDAVHDG
DWGKMVALRGTDIVRVSLEEATAELKLVPIHRYEEAEVFFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgaatcggagtgctgaccggtggcggtgactgccccgggctcaacgcggtgatccgc
gccgtcgtccgcaagggcatcagcgtgtacggctacgagttcgtcggcttccgggacggc
tggcggggtccgctcgagtgcgacaccatgccgctcgacatccaggccgtccggggcatc
ctcccgcgcggcggcaccatcctcggcacctcgcgcaccaacccgctgaagctcgaggac
ggtgtggagcgcatcaagcagaacttcgagaagctgggcgtcgacgcgctgatcgccatc
ggcggcgaggacacgctcggcgtcgccaagaagctccacgaccagggcgtcaaggtcgtc
ggcgtgccgaagacgatcgacaacgacctcaacgccaccgactacaccttcggcttcgac
accgcggtcaacatcgcgatggaggcgatcgaccggctccacaccacggccgagtcgcac
caccgcgccctgatctgcgaggtcatgggccgccacgccgggtggatcgccctgcacgcg
ggcatggccgccggggcgaacgtcatcctcatcccggagaagccgttcgacatcgacaag
gtctgcgagtacgtcgagtcccggttcaagacccgctacgcgccgatcatcgtggtcgcc
gagggcgcccacccgaaggagggccagctcgccgtccagagctcggagctggacgcgttc
ggccacgtccgcctcggcggcatcggtgaggcgctcgccaaggagatcgagaagcggacc
ggcaaggaggcgcggaccacggtcctcggccacatccagcgcggtggcacgcccacggcc
ttcgaccgggtgctcgccacccggttcggtctcggcgccatcgacgcggtccacgacggc
gactggggcaagatggtcgcgctccgcggcacggacatcgtccgggtgagcctcgaggag
gccaccgccgagctgaagctggtgccgatccaccgctacgaggaggccgaggtcttcttc
ggctga

DBGET integrated database retrieval system