KEGG   Thermobispora bispora: Tbis_1352Help
Entry
Tbis_1352         CDS       T01236                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tbi  Thermobispora bispora
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tbi00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tbi00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1528304..1529239
Genome map
AA seq 311 aa AA seqDB search
MKRHLLSAGDLSREDALLILDTAEELSKVSQRSIKKLPTLRGRTVVNLFFEDSTRTRISF
EAAAKRLSADVINFSARGSSVSKGESLKDTALTLEAMGADAVVIRHGASGAPHRLAGWIR
GSVINAGDGTHEHPTQALLDAFSIRRAMGRVEGLKVAIVGDVLHSRVARSNVQLLHTLGA
EVTLVGPPTLIPVAVDTWPCQVSYDFDAVLPKTDVVMMLRVQQERMNGAYFPSAREYSRR
YGLDRDRFAKLHDDAIVMHPGPLNRGMEISAEVADSPRSIIVEQVGNGVLVRMAVLYLLL
GGSESAIGGGE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggcacctgctctcggccggcgacctgagccgcgaggacgccctgctcatcctg
gacacggccgaggagctctccaaggtctcgcagcgctccatcaagaagctgccgaccctg
cgcggccgcacggtggtcaacctgttcttcgaggactccacccggacgcgcatctcgttc
gaggcggccgcgaagcggctctccgccgatgtcatcaacttctccgcgcgcgggtcgagc
gtgtccaagggcgagtcgctcaaggacaccgcgctcaccctcgaggcgatgggcgccgac
gccgtggtcatccggcacggggcctccggcgccccgcaccggctcgccggctggatccgc
ggcagcgtgatcaacgcgggcgacggcacccacgagcaccccacccaggcgctgctcgac
gcgttcagcatccgccgggccatgggccgggtggaggggctgaaggtcgcgatcgtcggc
gacgtgctgcacagccgggtggcgcggtcgaacgtccagctcctccacacgctcggcgcc
gaggtcaccctcgtcgggccgccgaccctgatcccggtcgcggtcgacacctggccgtgc
caggtctcgtacgacttcgacgccgtgctgcccaagacggacgtggtgatgatgctccgg
gtgcagcaggagcggatgaacggcgcctacttcccgtcggcgcgggagtacagccgccgc
tacggcctcgaccgcgaccggttcgccaagctccacgacgacgcgatcgtcatgcacccg
gggccgctcaaccgcggcatggagatctcggccgaggtggccgactccccgcggtcgatc
atcgtggagcaggtcggcaacggcgtgctcgtccggatggccgtgctctatctcctgctc
ggcgggtccgaatcggcgatcggaggtggcgagtga

DBGET integrated database retrieval system