KEGG   Thermobispora bispora: Tbis_1360Help
Entry
Tbis_1360         CDS       T01236                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tbi  Thermobispora bispora
Pathway
tbi00230  Purine metabolism
tbi01100  Metabolic pathways
Module
tbi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tbis_1360
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tbis_1360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_18 AAA_33 AAA_22 RsgA_GTPase AAA_29 MMR_HSR1 AAA_25 Rad17 ABC_tran AAA_30 AAA_28 CbiA Zeta_toxin AAA_5 RNA_helicase ParA AAA_23
Motif
Other DBs
NCBI-ProteinID: ADG88078
JGI: Tbis_1360
UniProt: D6Y9F8
Position
1539314..1539913
Genome map
AA seq 199 aa AA seqDB search
MPSESRAHGGGSSPRKPRLTVLSGPSGVGKSTVVAELRRSHPEVWLSVSVTTRKPRPGER
HGVEYYFVDDAEFDRMIASGELLEWAEFAGHRYGTPRTPVLQRLAAGVPALLEIDLQGAR
QVRAAMPDALLVFLAPPSWEELERRLRGRGTEPADVIERRLQAGRIEMAAEKEFDVTLVN
TDVKDVCRRLIALMTNSPS
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgcccagcgagtcccgggctcacggcggtggctcctcgcctcgtaagccgcgtctgacg
gtcctctccggtccgtcgggtgtcggcaagtccacggtcgtcgccgagctccggcggtca
caccccgaggtgtggctgtcggtctcggtgaccaccaggaagccccgcccgggggagagg
cacggcgtcgagtactacttcgtcgatgacgccgagttcgatcgcatgatcgcctcgggc
gagctcctggagtgggccgagttcgcgggccaccgctacggtacgccccgcactcccgtg
ctgcagcggctggcggccggcgtgccggcgctcctggagatcgatctccagggggcccgg
caggtgcgggccgccatgcctgatgccctgctcgtcttcctggctccgcccagctgggag
gagctggagcgccggctgcgcggcaggggcaccgagcccgccgacgtgatcgagcgccgg
ctccaggccgggcggatcgagatggcggccgagaaggagttcgacgtcactttggtgaac
acggacgtcaaagatgtgtgccgccggctgatagccttgatgacaaattcgccgagctag

DBGET integrated database retrieval system