KEGG   Thermobispora bispora: Tbis_1402Help
Entry
Tbis_1402         CDS       T01236                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tbi  Thermobispora bispora
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tbi00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tbi00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1582646..1584220
Genome map
AA seq 524 aa AA seqDB search
MRPAAVEARPISGLAALLGVPSAVHPPHPRGTRGVITGISIDSRRVQRGDLYVALPGSTA
HGADFAAEASAAGAVAILTDAAGRERAVATGLPVLVVPDPRAVLGRVAAWVYGNPTADLT
IIGVTGTSGKSTTTFLTEAGLRAAGHRTGLIGGVEIRVGDLRFPARLTTPEASELQALFA
LMREQGVTAAAMEVSSHALALGRVAEIIYDVAIFTNLSQDHLDFHRDLDDYFAAKARLFT
PDHSRLGVVNIDDRYGRELAERAKIPITTFSPSGDADADWRVADVRLGADGSVFRVVGPG
GVETDVSVALPGAFNVANALAALVALVEAGVPVPAAVAGIGMTTCVPGRMERVPGPGDIQ
VFVDYAHKPAAVESVLRSLRAVMGSGRRLVIVVGCGGDRDRGKRPLMGEAAARLADAAIF
TNDNPRSEDPLAILAAMLSGALRVPAAERAHVIVEPDRAAAIDLAISTARSGDVVLVAGK
GHEQGQYVGGRVIPFDDREVAAQAIARRARAHAAGLVGERAGGG
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgcgtccggcagccgtcgaggcccgcccgatctccgggctggccgcgctcctcggcgtg
ccctccgcagtccacccgcctcatccccggggcacccggggagtgatcaccgggatatcg
atcgactcgcgccgcgtgcagcgcggcgacctgtacgtggccctgccgggcagcacggcg
cacggcgccgacttcgccgcggaggcgagcgccgcgggcgccgtcgcgatcctgacggac
gcggccgggcgggagcgcgctgtcgcgaccgggctgcccgtgctcgtcgtgcccgatccc
cgggccgtgctcgggcgggtggccgcctgggtgtacggcaacccgaccgccgacctgacg
atcatcggcgtgaccgggaccagcggcaagagcaccacgaccttcctgaccgaggcgggc
ctgcgggcggccggccaccgcaccggcctgatcggcggggtggagatccgggtgggggac
ctgcggttccccgcgcggctgaccaccccggaggcgagcgagctgcaggccctgttcgcg
ctcatgcgggaacagggggtcaccgcggccgcgatggaggtgtccagccacgccctcgct
ttggggcgggtggccgagatcatttacgatgtcgccatcttcaccaacctctcccaagat
catcttgacttccatcgcgacctcgacgactacttcgccgccaaggcgcggttgttcacc
ccggaccactcccggctgggcgtggtgaacatcgacgatcggtacggccgcgagctcgcc
gagcgggcgaagatcccgatcaccaccttctccccgtccggcgacgccgacgccgactgg
cgggtggcggacgtccgcctcggcgccgacgggagcgtcttccgggtcgtcggcccgggc
ggcgtggagaccgacgtgagcgtcgccctcccgggcgccttcaacgtggccaacgcgctc
gccgcgctggtcgcgctggtggaggcgggcgtgcccgtcccggcggcggtggccggcatc
ggcatgacgacctgcgtccccggccgcatggagcgggtcccgggcccgggggacatccag
gtgttcgtggactacgcgcacaagcccgccgcggtcgagtcggtgctccgctcgctccgc
gcggtgatgggctccggccgccgtctcgtgatcgtggtggggtgcggcggcgaccgcgac
cgggggaagcggccgctcatgggagaggcggccgcgcggctcgccgatgcggcgatcttc
acgaatgacaacccccggagcgaggacccgctcgcgatcctcgccgccatgctctccggg
gcgctccgggtcccggcggcggaacgggcccacgtgatcgtggagccggaccgggccgcc
gccatcgacctggcgatttccactgccaggtccggagatgtggtacttgtggcgggtaag
gggcacgagcaaggtcagtatgtcggaggccgggtcatccccttcgacgaccgtgaggtg
gccgcgcaggccatcgcgcgacgagccagggcgcacgcggccgggctggtcggcgagagg
gccggcggtgggtga

DBGET integrated database retrieval system