KEGG   Thermobispora bispora: Tbis_1434Help
Entry
Tbis_1434         CDS       T01236                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
tbi  Thermobispora bispora
Pathway
tbi00340  Histidine metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01230  Biosynthesis of amino acids
Module
tbi_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Tbis_1434
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Tbis_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADG88152
JGI: Tbis_1434
UniProt: D6YA09
Position
1626727..1628049
Genome map
AA seq 440 aa AA seqDB search
MVISRIDLRGSLPGDLRDVLPRAELDVEAAVERVRPICEDVRRRGVAAVRELTKRFDGVE
LESTRVPAAALERALAELDPKVQAALEESIRRARKVHRDQRRTDITTTVVPGGTVTERWV
PVDRVGLYVPGGRAVYPSSVVMNVVPAQEAGVPSLAVTSPAQPDFGGLPHPVILAACALL
GVEEVYAVGGAQAVAMFAYGTEECAPVTMVTGPGNIWVAAAKRLLKGRIGIDSEAGPTEI
AILADATADPVHVAADLISQAEHDVIAAAVLVTDSEELADAVEAELAVQVAATKHSERIA
EALSGRQSGIVLVSDLEDGLAVVNAYAAEHLEIMTADAHEVAARVRNAGAIFIGPYSPVS
LGDYLAGSNHVLPTGGCACHSSGLSVQTFLRGIHVVDYTREALAEAAPYVCTLADAEDLP
AHGAAIRARFGWSIPGGRNG
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggtgatttcccggattgatctgcgtgggtctctccccggcgacctgcgggatgtgctg
ccccgcgccgaactcgacgtcgaggccgccgtggagcgggtgcggccgatctgcgaggac
gtccgccgccgcggtgtggcggccgtgcgggagctgaccaagaggttcgacggtgtcgag
ctggagtccacccgcgtgccggccgccgcgctggagcgggcgctcgccgagctcgacccc
aaggtccaggccgcgctcgaggagtcgatccggcgggcccgcaaggtccaccgcgaccag
cggcgcacggacatcaccacgacggtcgtgccgggcggcacggtcaccgagcgctgggtg
cccgtggaccgcgtcggcctctacgtgccgggcggccgggcggtctacccctcgagcgtc
gtgatgaacgtggtccccgcgcaggaggcgggggtcccctcgctcgccgtgacctcgccc
gcccagccggacttcggcggcctgccccacccggtgatcctcgccgcgtgcgcgctcctc
ggcgtcgaggaggtctacgcggtgggcggggcgcaggccgtcgcgatgttcgcctacggc
accgaggagtgcgccccggtgaccatggtcaccggcccgggcaacatctgggtggccgcg
gcgaagcggctgctcaagggccggatcgggatcgactccgaggccgggcccaccgagatc
gccatcctcgcggacgccacggccgacccggtgcacgtcgccgccgacctgatcagccag
gccgagcacgacgtgatcgccgccgccgtgctcgtgacggacagcgaggagctcgccgac
gcggtcgaggccgagctcgccgtccaggtcgccgccaccaagcactcggagcggatcgcc
gaggcgctctccgggcggcagtcgggcatcgtgctcgtctccgacctggaggacgggctc
gccgtggtcaacgcgtacgcggccgagcacctggagatcatgaccgccgacgcccacgag
gtcgccgcccgggtgcgcaacgccggtgcgatcttcatcggcccgtactccccggtctcc
ctcggcgactacctcgccggctccaaccacgtgctgccgacgggcggctgcgcgtgccac
tcctccggcctgtccgtgcagaccttcctccggggcatccacgtcgtggactacacccgc
gaggcgctcgccgaggcggcgccgtacgtctgcacgctcgccgacgccgaggacctgccg
gcgcacggcgcggcgatccgcgcgcggttcgggtggagcatccccggcgggcggaacggg
tga

DBGET integrated database retrieval system