KEGG   Thermobispora bispora: Tbis_1451Help
Entry
Tbis_1451         CDS       T01236                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tbi  Thermobispora bispora
Pathway
tbi00260  Glycine, serine and threonine metabolism
tbi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01130  Biosynthesis of antibiotics
tbi01230  Biosynthesis of amino acids
Module
tbi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_1451
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbis_1451
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbis_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DFP
Motif
Other DBs
NCBI-ProteinID: ADG88169
JGI: Tbis_1451
UniProt: D6YA26
Position
1641623..1642867
Genome map
AA seq 414 aa AA seqDB search
MTATEGSLLTPADLVGHGVRGDDPDARGKFGVFGGRYVPEALIPALDQVAAEYEKARNDP
AFVAELDHLLRTYAGRPTPITEVPRFARHAGGARILLKREDLTHTGAHKINNVLGQALLT
KRLGKTRVIAETGAGQHGVATATAAALMGLECTIYMGAVDCERQALNVARMKLLGATVVP
VTTGSQTLKDAINEAFRDWVTNVDHTHYVFGTVAGPHPFPEIVRDFARIIGVEARRQVLE
LTGRLPDAVAAAVGGGSNAIGIFHAFLDDEGVRLHGFEAAGRGADTDEHALTLTKGSVGV
LHGARTYVLQDDEGQTLPSHSISAGLDYPGVGPEHAWLKETGRATYHGVTDDEAMEAFAL
LARTEGIIPALESAHALAGALRLGRELGPEATILVNLSGRGDKDMGTAMKYFNL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgcgacggaaggcagcctgctcacccccgccgatctggtcggtcacggcgtccgc
ggtgacgacccggacgcccgcggcaagttcggcgtgttcgggggcaggtacgtgcctgag
gcactgatcccggccctcgaccaggtggcggccgagtacgagaaggcgcggaacgacccg
gcgttcgtcgccgagctcgaccacctgctccgcacgtacgccgggcggcccaccccgatc
accgaggtgccgcggttcgcccggcacgcgggcggcgcgcgcatcctgctcaagcgcgag
gacctcacccacaccggcgcccacaagatcaacaacgtgctcggccaggccctgctcacc
aagcggctcggcaagacccgggtgatcgcggagaccggagcgggccagcacggcgtcgcc
accgcgacggccgcggcgctcatggggctggagtgcaccatctacatgggcgccgtcgac
tgcgagcgccaggcgctcaacgtcgcgcggatgaagctgctcggcgcgaccgtcgtgccc
gtgacgaccggcagccagaccctcaaggacgcgatcaacgaggcgttccgcgactgggtc
accaacgtcgaccacacgcactacgtgttcggcacggtcgccgggccgcaccccttcccg
gagatcgtccgcgacttcgcccggatcatcggggtggaggcgcggcggcaggtcctcgag
ctcaccggtcggctgcccgacgcggtcgcggccgcggtcggcggcgggtccaacgcgatc
ggcatcttccacgccttcctcgacgacgagggggtgcgcctccacggcttcgaggcggcc
ggccgcggcgcggacacggacgagcacgcgctcaccctgaccaaggggagcgtcggcgtg
ctccacggcgcccgcacctacgtgctgcaggacgacgagggccagacgctcccgtcgcac
tcgatctcggccggcctcgactacccgggggtcggccccgagcacgcctggctgaaggag
accggccgcgccacctaccacggcgtcaccgatgacgaggcgatggaggccttcgccctg
ctcgcccggaccgagggcatcatcccggccctggagtcggcgcacgccctcgccggcgcg
ctgcggctcggccgcgagctcggcccggaggcgaccatcctggtgaacctctccggccgc
ggtgacaaggacatgggcaccgcgatgaagtacttcaacctctga

DBGET integrated database retrieval system