KEGG   Thermobispora bispora: Tbis_1452Help
Entry
Tbis_1452         CDS       T01236                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tbi  Thermobispora bispora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbis_1452
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_1452
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbis_1452
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbis_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642902..1643693
Genome map
AA seq 263 aa AA seqDB search
MTTLQAVFEKARAEDRAALVGYLPAGFPTKDGAVAAATAMVEGGCDVIEIGLPYSDPLMD
GPTIQDAVHRSLTNGTRIADVLRTVEQVARTGAATLVMTYWNPVDRYGPERFARDLASAG
GAGTITPDLTPEEAGPWLEASRAAGIDTVFLIAPSSTEERIARVVECCTGFVYAASLMGV
TGTRDTVSAAAEGLVKRARAHTTLPICVGLGVSSGAQAAEVARYADGVIVGSAFIKRLLD
APDEASGLAAVRALAEELARGVR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgactctccaggcggtgttcgagaaggcgcgggccgaggaccgggccgccctcgtc
ggttaccttccggccggattccccaccaaggacggcgcggtcgcggccgcgacggcgatg
gtggagggcggctgcgacgtgatcgagatcggcctgccgtactccgatccgctcatggac
gggcccaccatccaggacgcggtgcaccgctcgctcaccaacggcacccggatcgccgac
gtgctccgcacggtcgagcaggtggcccgcaccggggcggccacgctcgtcatgacgtac
tggaacccggtcgaccgctacgggcccgagcgcttcgcgcgcgacctcgcctcggcgggc
ggggccgggaccatcacccccgacctcaccccggaggaggccgggccctggctggaggcg
agccgggccgcggggatcgacacggtcttcctcatcgcgccgagctccaccgaggagcgg
atcgcgcgcgtggtggagtgctgcaccggcttcgtctacgccgcctcgctcatgggggtc
accggcacccgggacacggtgagcgccgcggccgagggcctggtgaagcgggcccgggcg
cacaccacgctgcccatctgcgtggggctcggggtgagctcgggggcgcaggcggccgag
gtggcccggtacgccgacggggtcatcgtgggctcggccttcatcaagcggctgctcgat
gcgccggacgaggcgtccggcctcgccgcggtgcgcgcgctcgccgaggagctcgcccgc
ggcgtgcggtga

DBGET integrated database retrieval system