KEGG   Thermobispora bispora: Tbis_1452Help
Entry
Tbis_1452         CDS       T01236                                 

Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tbi  Thermobispora bispora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbis_1452
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_1452
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbis_1452
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbis_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1642902..1643693
Genome map
AA seq 263 aa AA seqDB search
MTTLQAVFEKARAEDRAALVGYLPAGFPTKDGAVAAATAMVEGGCDVIEIGLPYSDPLMD
GPTIQDAVHRSLTNGTRIADVLRTVEQVARTGAATLVMTYWNPVDRYGPERFARDLASAG
GAGTITPDLTPEEAGPWLEASRAAGIDTVFLIAPSSTEERIARVVECCTGFVYAASLMGV
TGTRDTVSAAAEGLVKRARAHTTLPICVGLGVSSGAQAAEVARYADGVIVGSAFIKRLLD
APDEASGLAAVRALAEELARGVR
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacgactctccaggcggtgttcgagaaggcgcgggccgaggaccgggccgccctcgtc
ggttaccttccggccggattccccaccaaggacggcgcggtcgcggccgcgacggcgatg
gtggagggcggctgcgacgtgatcgagatcggcctgccgtactccgatccgctcatggac
gggcccaccatccaggacgcggtgcaccgctcgctcaccaacggcacccggatcgccgac
gtgctccgcacggtcgagcaggtggcccgcaccggggcggccacgctcgtcatgacgtac
tggaacccggtcgaccgctacgggcccgagcgcttcgcgcgcgacctcgcctcggcgggc
ggggccgggaccatcacccccgacctcaccccggaggaggccgggccctggctggaggcg
agccgggccgcggggatcgacacggtcttcctcatcgcgccgagctccaccgaggagcgg
atcgcgcgcgtggtggagtgctgcaccggcttcgtctacgccgcctcgctcatgggggtc
accggcacccgggacacggtgagcgccgcggccgagggcctggtgaagcgggcccgggcg
cacaccacgctgcccatctgcgtggggctcggggtgagctcgggggcgcaggcggccgag
gtggcccggtacgccgacggggtcatcgtgggctcggccttcatcaagcggctgctcgat
gcgccggacgaggcgtccggcctcgccgcggtgcgcgcgctcgccgaggagctcgcccgc
ggcgtgcggtga

DBGET integrated database retrieval system