KEGG   Thermobispora bispora: Tbis_1757Help
Entry
Tbis_1757         CDS       T01236                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tbi  Thermobispora bispora
Pathway
tbi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tbis_1757
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tbis_1757
DNA repair and recombination proteins [BR:tbi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Tbis_1757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 HHH AAA_11 Helicase_RecD PIF1 AAA_22 HHH_2 HHH_3 PhoH AAA_16 UvrD_C TrwB_AAD_bind AAA_10 AAA_12 AAA NACHT DEAD
Motif
Other DBs
NCBI-ProteinID: ADG88470
JGI: Tbis_1757
UniProt: D6YBB0
Position
2032722..2034962
Genome map
AA seq 746 aa AA seqDB search
MGVGLEGSERNKPNGVTLKGTLERITYVNEETGYTIARLATERSDKELLTVVGPLLGAQV
GESLLLTGRWTTHPRYGRQFEVWSYTTLLPATIQGIQRYLGSGLIKGIGPKMAERIVNHF
GTDTLRVIEEEPERLTEVPGLGPKRMKMIADAWEEQKIIKEVMVFLQGVGVSTSIAVRIF
KQYGEASINVVRNEPYRLADEVWGIGFKTADAIARSIGIPHDSPGRVKAGLRYTLSQAAD
NGHCYLPAPNLIAEAVKILDVPQDLAAKCLEELIAEEGVIREDIPAGENGESAIPAIYLV
PFHRAEQSLAATLRGLLTADRDRLAAFANVDWDAAFDWLHARTGGARLAPEQAEAVRLAL
TEKVAILTGGPGCGKSFTVRSIVMLARAKRAKVVLAAPTGRAAKRLAELTGHEATTVHRL
LQLRPGGDASFDRDNPLDADLVVVDEASMLDLLLANKLAKAVPKGAHLLFVGDVDQLPSV
GAGEVLRDLLAAPEIPRVRLTRIFRQAQESGVVVNAHRVNSGKPPLVREFPDFFLFPAED
PEEIARLTVDVVARRIPARFGLDPRRDVQVLVPMHRGVAGAAALNVALQEALTPYREGVP
ERRYGGRVFRVGDKVTQLRNNYDKGAAGVFNGTVGVVTDISLEESTLTVRTDEDESVDYS
FDELDELAHAYAVSIHRSQGSEYPAVVIPLATSAWMMLQRNLLYTAITRAKRLVVIVGSR
RAIWQAVRTKGAGRRYTGLTHRLRAR
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtgggattggagggttccgagaggaacaaaccgaacggcgtcacgttgaaaggg
accctcgaacggatcacgtacgtcaacgaggagaccggttacacgatcgcccggctcgcc
accgagcgctcggacaaggagctgctcaccgtcgtcgggccgctcctcggcgcccaggtc
ggcgaatcgctgctgctgaccgggcggtggaccacccacccgcggtacggccggcagttc
gaggtgtggtcgtacacgaccctgctgccggcgaccatccagggcatccagcgctacctc
ggctccggcctgatcaagggcatcggcccgaagatggccgagcggatcgtcaaccacttc
ggcaccgacacgctgcgggtgatcgaggaggagcccgagcggctcaccgaggtccccggg
ctcggccccaagcggatgaagatgatcgccgacgcctgggaggagcagaagatcatcaag
gaggtgatggtcttcctccagggcgtgggcgtgtccacctcgatcgcggtccgcatcttc
aagcagtacggcgaggcgtcgatcaacgtggtgcgcaatgagccgtaccggctcgcggac
gaggtgtggggcatcgggttcaagaccgccgacgcgatcgcccggtcgatcgggatcccg
cacgacagcccgggccgggtcaaggccggcctgcgctacacgctctcccaggcggccgac
aacggccactgctacctgccggccccgaacctgatcgccgaggcggtcaagatcctcgac
gtgccgcaggacctggccgcgaagtgcctggaggagctgatcgccgaggagggcgtgatc
cgcgaggacatcccggccggggagaacggggagagcgccatccccgccatctacctggtg
ccgttccaccgggcggagcagtccctggccgccaccttgcgcgggctcctcaccgccgat
cgcgaccggctcgcggcgttcgcgaacgtcgactgggacgcggcgttcgactggctccac
gcccggaccggcggcgcccggctcgcccccgagcaggccgaggccgtacggctcgcgctc
accgagaaggtcgcgatcctcaccggcgggccggggtgcggcaagagcttcaccgtccgg
tcaatcgtcatgctggcgcgggccaaacgggccaaggtcgtgctcgccgcccccaccggg
cgggcggcgaagcggctcgccgagctcaccgggcacgaggccaccaccgtgcaccgcctg
ctccagctcaggcccggcggggacgcctccttcgaccgggacaacccgctcgacgccgac
ctcgtcgtggtcgacgaggcctccatgctcgacctgctgctcgccaacaagctcgccaag
gccgtgccgaagggggcccacctgctgttcgtcggcgacgtggaccagctcccctcggtc
ggcgcgggcgaggtgctgcgggacctgctcgccgccccggagatcccccgggtacggctg
acgcggatcttccgccaggcccaggagtccggggtggtggtcaacgcgcaccgggtgaac
tccggcaagccgcccctggtgcgggagttcccggacttcttcctgttcccggccgaggac
cccgaggagatcgccaggctcaccgtcgacgttgtggcccggcgcatcccggccaggttc
gggctcgacccgcggcgggacgtgcaggtgctcgtcccgatgcaccggggcgtcgccggg
gccgccgcgctcaacgtcgccctgcaggaggcgctcaccccgtaccgggagggcgtcccc
gagcgccggtacggcgggcgggtgttccgcgtgggcgacaaggtcacccagctccgcaac
aactacgacaagggcgcggccggggtgttcaacggcacggtcggcgtggtcaccgacatc
tccctggaggagagcacgctcaccgtccgcaccgacgaggacgagagcgtggactactcc
ttcgacgagctggacgagctggcccacgcgtacgcggtgagcatccaccgctcacagggg
agcgagtatccggcggtggtgatcccgctggcgaccagcgcgtggatgatgctgcagcgc
aacctgctctacaccgcgatcacccgggcgaagcggctcgtggtcatcgtggggtcgaga
cgggcgatctggcaggcggtgcggaccaagggggcgggccgccgctacaccgggctcacc
caccggttgcgcgcccgatga

DBGET integrated database retrieval system