KEGG   Thermobispora bispora: Tbis_1991Help
Entry
Tbis_1991         CDS       T01236                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tbi  Thermobispora bispora
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tbis_1991
   01230 Biosynthesis of amino acids
    Tbis_1991
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tbis_1991
   00051 Fructose and mannose metabolism
    Tbis_1991
   00562 Inositol phosphate metabolism
    Tbis_1991
Enzymes [BR:tbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tbis_1991
Exosome [BR:tbi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tbis_1991
  Exosomal proteins of bladder cancer cells
   Tbis_1991
  Exosomal proteins of melanoma cells
   Tbis_1991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2305198..2305980)
Genome map
AA seq 260 aa AA seqDB search
MADRKPLIAGNWKMNLNHLEAIALVQKLAFSLTDKDYDKVDVAVLPPFTDLRSVQTLVAG
DKLRILYGAQDLSAHDSGAYTGEISGAMLAKLGCTFTLVGHSERRQYHHEDDALCNAKLK
AAFRHGLTPILCVGEGLPIRQEGRHVEYTLEQLDGALSGIPAEQAKSIVVAYEPVWAIGT
GEVATPKDAQEVCGAIRSRLAESYGDEVAQVVRILYGGSVKSGNIAGIMAEPDIDGALVG
GASLDAGEFVKICRFGENSG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgcaagccgctgatcgccggcaactggaagatgaacctcaaccatctcgag
gccatcgcgctcgtccagaagctggcgttctcgctgaccgacaaggactacgacaaggtg
gacgtcgcggtgctcccgccgttcaccgacctgcgcagcgtgcagaccctggtcgcgggg
gacaagctccgcatcctgtacggcgcgcaggacctgtcggcgcacgactcgggcgcctac
accggggagatctcgggtgcgatgctcgccaagctcgggtgcaccttcaccctggtgggt
cactccgagcgccggcagtaccaccacgaggacgacgcgctctgcaacgccaagctcaag
gccgcgttccgccacgggctcaccccgatcctgtgcgtgggcgagggcctgccgatccgc
caggagggccgccacgtcgagtacacgctcgagcagctcgacggcgcgctgtccgggatc
ccggccgagcaggcgaagtcgatcgtggtggcgtacgagccggtctgggcgatcggcacc
ggggaggtcgccacgccgaaggacgctcaggaggtgtgcggggccatccggtcccggctc
gccgagagctacggagacgaggtggcgcaggtcgtccgtatcctgtacggaggatcggtg
aagtcggggaacatcgccggcatcatggcggagcccgacatcgacggcgccctcgtcggc
ggggcgagcctcgatgcgggggagttcgtcaagatctgccggttcggtgagaactccggc
tga

DBGET integrated database retrieval system