KEGG   Thermobispora bispora: Tbis_2139Help
Entry
Tbis_2139         CDS       T01236                                 

Definition
family 10 glycoside hydrolase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
tbi  Thermobispora bispora
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2486953..2488377
Genome map
AA seq 474 aa AA seqDB search
MSVRSPRRHAWKIGLALLIGVIPAVATATTADAAAPLRQLAEAKGIYFGTAVAANRLGES
QYVQVLDREFNSVTPENEMKWDATEPSRNSFNFGSADQIVNHAQANGQIIRGHTLVWHSQ
LPSWVSNGNWTASELTQVMENHISNVAGRYRGKLYAWDVVNEAFNEDGTRRQTVFQRVLG
DGYIATAFRAARAADPTAKLYYNDYNIEGINAKSNAVYNMVRQFKQQGVPIDGVGFQGHF
ILGQVPNDLQQNLQRFADLGVEVALTEVDIRIPLPVTSAKLAQQRADYEKVVRACLAVSK
CVGVTVWGVTDKYSWVPDVFPGEGAALLFDDNYNPKPAYDGVVTALGGDSSPSPTPTLTP
SPIPDSPPSPPPSSGCTATYRLVNEWPGGFQAEVTVSNNGTSPINGWTVSWSFPSGQTIT
QLWNGEHTQSGANVTVRNVYYNGNVAPGASTSFGFLGSFSGSNGAPSSVSCTAS
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgtccgttcgatcacctagacgccacgcctggaagatcggactggcgctgctgatcggc
gtgatcccggcggtcgccaccgccaccaccgccgacgcggccgcgccgctccgccagctc
gccgaggccaagggcatctacttcggcacggcggtcgcggccaaccggctcggcgagagc
cagtacgtccaggtcctcgaccgcgagttcaactccgtcacccctgagaacgagatgaag
tgggacgccaccgagccgtcccgcaactcgttcaacttcggcagcgcggaccagatcgtc
aaccacgcccaggccaacgggcagatcatccgcggccacaccctcgtctggcacagccag
ctcccgtcgtgggtgagcaacggcaactggaccgccagtgagctcacccaggtcatggag
aaccacatctccaacgtggccggccgctaccgcggcaagctctacgcctgggacgtcgtc
aacgaggccttcaacgaggacggcacccgccgccagaccgtcttccagcgggtgctcggc
gacggctacatcgccacggcgttccgggccgcccgggccgccgaccccacggccaagctg
tactacaacgactacaacatcgaggggatcaacgcgaagagcaacgccgtctacaacatg
gtgcgccagttcaagcagcagggcgtgcccatcgacggcgtgggcttccagggccacttc
atcctcggccaggtccccaatgacctgcagcagaacctgcagcgcttcgccgacctcggc
gtggaggtcgcgctgaccgaggtcgacatccggattccgctgccggtcacctccgccaag
ctcgcccagcagcgggccgactacgagaaggtggtccgggcctgcctcgccgtctccaag
tgcgtgggcgtcaccgtctggggcgtcacggacaagtactcctgggtgccggacgtcttc
ccgggcgagggcgcggcgctgctgttcgacgacaactacaaccccaagcccgcctacgac
ggcgtggtcaccgccctcggcggtgactcgagcccgagcccgaccccgactctgacgccc
tcgccgatccccgactctccgcccagcccgccgccgagcagcggatgcaccgccacctac
cggctcgtcaacgaatggcccggcggcttccaggccgaggtgacggtcagcaacaacggc
acgtcaccgatcaacgggtggaccgtgtcctggtcgttcccgagcggccagaccatcacc
cagctctggaacggcgagcacacccagtcgggcgccaacgtgaccgtgcggaacgtctac
tacaacggcaacgtcgcgcccggtgcctccacctcgttcgggttcctcggcagcttctcc
ggcagcaacggcgccccgtcgtcggtgagctgcacggcatcctga

DBGET integrated database retrieval system