KEGG   Thermobispora bispora: Tbis_2262Help
Entry
Tbis_2262         CDS       T01236                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
tbi  Thermobispora bispora
Pathway
tbi00860  Porphyrin and chlorophyll metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tbis_2262
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Tbis_2262
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Tbis_2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 Thi4 NAD_binding_9 HI0933_like Pyr_redox Lycopene_cycl FAD_oxidored Trp_halogenase MCRA GIDA AlaDh_PNT_C FAD_binding_3 Pyr_redox_3 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ADG88972
JGI: Tbis_2262
UniProt: D6Y397
Position
complement(2626158..2627606)
Genome map
AA seq 482 aa AA seqDB search
MDGISGQHVVVVGAGIAGLAAALYLSRAERNLRVTVLEAAPRIGGKLYSTPLAGVEIDAG
AEALLAARPEAKELVRLAGLGDELVDCGTSGSAILSRGSLRPLPKGSVMGIPTDLPALAR
SGILSPAGLARAGLDLVLPPTPATVDVPVAAYIRARLGQEVVDRLVEPMLGGVYAGHADR
LSLRATLPSISGIARTGRSLIRALWETGKRPKPAGPVFVTLRRGLGSLPEAVAKASGADV
RTGVTVRDLVRTPGGWRVVTGTGGTEEAIEADGVVLAVPARVAARLLRRELPGAAAELSG
IGYASVAIVTLAYPKAVFPRTTVGSGYLIPPVERRPVKAVTFSSVKWPHLAEAGRDLVFV
RCSIGRLGEEMLLQRDDAELAALAQEELTETLGVGDRPIDVRVTRWGGALPQYEVGHLDR
IARARAAVAAQPGLALCGAAYDGVGIPACIASARTAVSQVLARLGTAGAPAGPDPSAGRM
GA
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggatgggatctctggtcagcacgtggtcgtcgtcggcgccgggatcgccggcctcgcc
gccgccctgtacctgagccgggcggagcggaacctccgggtcaccgtgctcgaggcggcg
ccccggatcgggggcaagctgtactcgaccccgctcgccggcgtggagatcgacgccggg
gccgaggcgctgctcgcggcccgccccgaggccaaggagctggtgcgcctcgccgggctc
ggcgacgagctcgtcgactgcggcacgagcggctcggccatcctgtcccggggatccctc
cgcccgctgcccaaggggagcgtcatgggcatccccaccgacctgcccgcgctcgcccgc
tccggcattctctccccggccggcctcgcccgcgccggcctcgacctggtgctcccgccc
acgccggcgacggtggacgtgccggtcgccgcctacatccgggcgcggctgggccaggag
gtggtcgaccggctggtcgagccgatgctcggcggggtgtacgccggccacgccgaccgc
ctctccctccgggccaccctgccgtcgatctccgggatcgcccggaccgggcggtccctg
atcagggcgctctgggagacgggcaagcggcccaagccggccggcccggtcttcgtcacc
ctccgccgcggcctcggctccctgcccgaggcggtggcgaaggcctccggggccgacgtc
cgcaccggggtcaccgtgcgcgacctggtccgcacccccggcggctggcgggtcgtcacc
ggcaccggcggcaccgaggaggcgatcgaggccgacggggtggtcctcgccgtgcccgcc
cgggtcgcggcccgcctgctgcgccgggagttgccgggggccgcggccgagctgagcggc
atcggctacgcgagcgtggcgatcgtcaccctcgcctacccgaaggcggtcttcccccgc
accaccgtgggcagcggctacctgatcccgcccgtggagcgccggccggtgaaggcggtg
acgttcagctcggtcaagtggccgcacctcgccgaggccggccgcgacctcgtcttcgtc
cggtgctcgatcgggcggctgggggaggagatgctgctccagcgggacgacgccgagctg
gccgcgctcgcccaggaggagctcaccgagaccctcggggtgggggaccggccgatcgac
gtgcgggtcacccggtggggcggggccctcccgcagtacgaggtcggccacctcgaccgg
atcgcccgcgcccgcgccgccgtggccgcccagccggggctggcgctctgcggcgccgcc
tacgacggggtggggatcccggcctgcatcgcctccgcccgcaccgcggtttcgcaggtc
ctggcgcggctgggcacggccggggcgcctgcgggaccggacccctccgcgggcagaatg
ggggcatga

DBGET integrated database retrieval system