KEGG   Thermobispora bispora: Tbis_2580Help
Entry
Tbis_2580         CDS       T01236                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tbi  Thermobispora bispora
Pathway
tbi00300  Lysine biosynthesis
tbi01100  Metabolic pathways
tbi01120  Microbial metabolism in diverse environments
tbi01230  Biosynthesis of amino acids
Module
tbi_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tbis_2580
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tbis_2580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADG89282
JGI: Tbis_2580
UniProt: D6Y587
Position
complement(3029688..3030761)
Genome map
AA seq 357 aa AA seqDB search
MNAVELTRELIRLQTVAGGEQRAAELLAGRLEEAGYAVELHSAAPGRTGLVARRGRGERF
ITLSGHLDTVPLGAEAWRHDPFAAERDGDLLYGRGASDMKAGVAAIVAAAAECPADVPVQ
LALTWGEETGCEGAADLAARGVLAPAAVLLIAEPTANRVVPGHKGALWLRATAYGTAAHG
SMPHLGDNAIYKLARAVLAARDFRFGVAPHRWMGAPTLNVGTIAGGSGTNAVPDRAEATI
DVRTVAGQDHAAARAELAGALGEEIDLAVLLDLPPVWTPTEDPWVARLVAAGAGEPTGAA
TYFTDASVLRPALGDPPTLICGPGEPDQAHVTDEHCRVSRIEEAVGIYRAVLAQAAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagtggaactcacccgggagctgatccgcctgcagaccgtggccgggggcgag
cagcgggccgccgagctgctcgccggccggctggaggaggccggatacgccgtcgagctc
cattccgccgcccccgggcggaccggcctggtcgcccggcgcggccggggcgagcggttc
atcaccctctccgggcacctcgacaccgtgccgctcggcgcggaagcgtggcgccacgac
ccgttcgcggccgagcgcgacggcgacctgctctacggccggggcgcgagcgacatgaag
gccggggtggccgccatcgtcgcggcggccgcggagtgcccggcggacgtgcccgtgcag
ctcgccctcacctggggcgaggagaccgggtgcgaaggcgccgccgacctcgccgcgcgc
ggggtgctcgcccccgccgccgtgctgctgatcgccgagcccaccgccaaccgggtcgta
cccgggcacaagggggccctgtggctccgcgccaccgcgtacggcaccgccgcgcacggc
tccatgccgcacctcggcgacaacgcgatctacaagctcgcccgggccgtgctggccgcc
cgggacttccggttcggcgtcgccccgcaccggtggatgggcgcgccgacgctgaacgtg
ggcacgatcgccggtgggtccggcaccaacgccgtccccgaccgggccgaggcgaccatc
gacgtccgcaccgtcgccgggcaggaccacgccgcggcccgcgccgagctcgccggggcg
ctgggggaggagatcgacctggcggtgctcctcgacctgccgccggtgtggaccccgacg
gaggacccctgggtggcccggctggtcgcggccggggcgggcgagcccaccggggcggcg
acctacttcaccgacgcgtccgtgctccggcccgcgctcggcgacccgcccaccctgatc
tgcggcccgggggagccggaccaggcccacgtgaccgacgagcactgccgggtgagccgc
atcgaggaggcggtcggcatctaccgcgccgtgctcgcccaggccgccgcgtga

DBGET integrated database retrieval system