KEGG   Thermobispora bispora: Tbis_2580Help
Entry
Tbis_2580         CDS       T01236                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tbi  Thermobispora bispora
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tbi01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tbi00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3029688..3030761)
Genome map
AA seq 357 aa AA seqDB search
MNAVELTRELIRLQTVAGGEQRAAELLAGRLEEAGYAVELHSAAPGRTGLVARRGRGERF
ITLSGHLDTVPLGAEAWRHDPFAAERDGDLLYGRGASDMKAGVAAIVAAAAECPADVPVQ
LALTWGEETGCEGAADLAARGVLAPAAVLLIAEPTANRVVPGHKGALWLRATAYGTAAHG
SMPHLGDNAIYKLARAVLAARDFRFGVAPHRWMGAPTLNVGTIAGGSGTNAVPDRAEATI
DVRTVAGQDHAAARAELAGALGEEIDLAVLLDLPPVWTPTEDPWVARLVAAGAGEPTGAA
TYFTDASVLRPALGDPPTLICGPGEPDQAHVTDEHCRVSRIEEAVGIYRAVLAQAAA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcagtggaactcacccgggagctgatccgcctgcagaccgtggccgggggcgag
cagcgggccgccgagctgctcgccggccggctggaggaggccggatacgccgtcgagctc
cattccgccgcccccgggcggaccggcctggtcgcccggcgcggccggggcgagcggttc
atcaccctctccgggcacctcgacaccgtgccgctcggcgcggaagcgtggcgccacgac
ccgttcgcggccgagcgcgacggcgacctgctctacggccggggcgcgagcgacatgaag
gccggggtggccgccatcgtcgcggcggccgcggagtgcccggcggacgtgcccgtgcag
ctcgccctcacctggggcgaggagaccgggtgcgaaggcgccgccgacctcgccgcgcgc
ggggtgctcgcccccgccgccgtgctgctgatcgccgagcccaccgccaaccgggtcgta
cccgggcacaagggggccctgtggctccgcgccaccgcgtacggcaccgccgcgcacggc
tccatgccgcacctcggcgacaacgcgatctacaagctcgcccgggccgtgctggccgcc
cgggacttccggttcggcgtcgccccgcaccggtggatgggcgcgccgacgctgaacgtg
ggcacgatcgccggtgggtccggcaccaacgccgtccccgaccgggccgaggcgaccatc
gacgtccgcaccgtcgccgggcaggaccacgccgcggcccgcgccgagctcgccggggcg
ctgggggaggagatcgacctggcggtgctcctcgacctgccgccggtgtggaccccgacg
gaggacccctgggtggcccggctggtcgcggccggggcgggcgagcccaccggggcggcg
acctacttcaccgacgcgtccgtgctccggcccgcgctcggcgacccgcccaccctgatc
tgcggcccgggggagccggaccaggcccacgtgaccgacgagcactgccgggtgagccgc
atcgaggaggcggtcggcatctaccgcgccgtgctcgcccaggccgccgcgtga

DBGET integrated database retrieval system