KEGG   Thermobispora bispora: Tbis_2588Help
Entry
Tbis_2588         CDS       T01236                                 

Definition
PfkB domain-containing protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tbi  Thermobispora bispora
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tbis_2588
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tbis_2588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3037453..3038388
Genome map
AA seq 311 aa AA seqDB search
MSGVDVAVVGSVNLDLTVPVGRVPRPGETVLGADARRGPGGKGANQAVACARLGLRTAMI
GCVGEDADGGMLAERLRAEGVDVRHLVPVPAPTGLAMIILEEGDGESTIVVSPGANGRLD
AGRVRAAEGTITGARAVLAQLEIPIPAVAEAVRLATGTVVLNPAPARPLPRELLSRVDVL
VPNRHELAVLCQAPTPESPDEVADLARSLLPGGPRAVVVTLGADGAMVVTADGVARVPAV
PVRAVDATAAGDSFCAGLVAGLLAGEPLAEAAARGCRAAAVTVSRPGAIDALPTAADLAA
PPAPGPAASPA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcggggtggacgtcgccgtcgtcggcagtgtcaacctcgacctcaccgtgccggtg
gggcgggtgccgcggccgggcgagaccgtgctcggcgcggacgcccgccgcgggccgggc
ggcaagggcgcgaaccaggccgtggcgtgcgcccggctcggcctgcgcacggccatgatc
ggctgcgtgggcgaggacgcggacggggggatgctcgccgagcggctccgcgcggagggc
gtggacgtccggcacctcgtcccggtgcccgcgccgaccggcctcgcgatgatcatcctc
gaggagggggacggggagagcacgatcgtggtgagcccgggcgccaacggccggctcgac
gccggccgggtgcgcgcggccgagggcacgatcaccggcgcgcgggccgtgctcgcccag
ctcgagatcccgatccccgccgtggccgaggccgtgcgcctggccaccggcacggtcgtg
ctcaaccccgccccggcgcggccgctcccccgggagctgctctcccgggtggacgtgctc
gtccccaaccggcacgagctcgccgtcctctgccaggcgcccaccccggagagcccggat
gaggtggccgacctcgcccggagcctgctgcccggcgggccgcgggcggtcgtggtcacc
ctcggcgccgacggggccatggtggtcaccgccgacggcgtggcccgggtgcccgcggtg
ccggtgcgggcggtggacgccacggccgccggggacagcttctgcgccggcctggtggcc
gggctgctcgccggggagccgctcgccgaggcggcggcccggggctgccgcgccgccgcg
gtcacggtctcccggcccggggcgatcgacgcgctgcccacggccgcggacctcgccgcc
cctcccgcgcccggccccgccgcctcgccggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system