KEGG   Thermobispora bispora: Tbis_2592Help
Entry
Tbis_2592         CDS       T01236                                 

Definition
urate oxidase (EC:1.7.3.3)
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
tbi  Thermobispora bispora
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tbis_2592
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    Tbis_2592
Enzymes [BR:tbi01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     Tbis_2592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3042381..3043286)
Genome map
AA seq 301 aa AA seqDB search
MAIVLGRNQYGKAEVRVFRVYRDTPRHEVRDLNVWTALRGDFTDAHVTGDQSHVLPTDTQ
KNTVYALAKKEGIRAIEDFALTLGDHFLRQVPAATGARIAIEEYAWDRIDVDGTGHDHGF
VRRGQGTRTTVVTVEGRGDERRAWVLSGISDLIIAKTTGSEFHGFLKDEYTTLEETHDRI
LATSLHTRWRYLTTDVDWDKTFASVRSILLRQFATVHSLALQQTLYAMGSAVLEAHPEIA
EIRLSAPNKHHFLVDLQPFGLDNPGEVFYASDRPYGLIEASVVRDDVPEAPEAWLATPGF
C
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggccatcgtcctcggacgcaaccagtacggcaaggcggaggtccgcgtgttccgggtc
taccgggacacgccgcggcatgaggtccgcgacctcaacgtgtggaccgcgctccgcggg
gacttcaccgacgcgcacgtcaccggcgaccagtcgcacgtgctgccgaccgacacccag
aagaacaccgtctacgccctcgccaagaaggagggcatccgggcgatcgaggacttcgcg
ctcacgctcggcgaccacttcctccggcaggtcccggccgccaccggggcgcgcatcgcc
atcgaggagtacgcctgggaccgcatcgacgtcgacggcaccgggcacgaccacggcttc
gtccgccgcggccagggcacccgcaccaccgtggtgaccgtcgagggccggggcgatgag
cgccgcgcctgggtgctctccggcatctccgacctgatcatcgccaagaccacggggtcg
gagttccacggcttcctcaaggacgagtacaccaccctggaggagacccacgaccggatc
ctcgccaccagcctgcacacccggtggcggtacctcaccaccgacgtcgactgggacaag
accttcgcctcggtccggtcgatcctgctgcggcagttcgccaccgtgcacagcctcgcg
ctccagcagacgctgtacgccatgggcagcgcggtgctcgaggcccacccggagatcgcg
gagatccggctctccgccccgaacaagcaccacttcctcgtcgacctgcagccgttcggc
ctcgacaacccgggcgaggtgttctacgcgtccgaccggccgtacgggctgatcgaggcg
tcggtggtgcgcgacgacgtgcccgaggcgcccgaggcctggcttgccacgcccggcttc
tgctga

DBGET integrated database retrieval system