KEGG   Thermobispora bispora: Tbis_2682Help
Entry
Tbis_2682         CDS       T01236                                 

Definition
L-lysine 6-transaminase
Orthology
K03918  
L-lysine 6-transaminase [EC:2.6.1.36]
Organism
tbi  Thermobispora bispora
Pathway
Metabolic pathways
Brite
Enzymes [BR:tbi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.36  L-lysine 6-transaminase
     Tbis_2682
Amino acid related enzymes [BR:tbi01007]
 Aminotransferase (transaminase)
  Class III
   Tbis_2682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3145230..3146504)
Genome map
AA seq 424 aa AA seqDB search
MDPSAVHETLARHLLVDGFDLVLDLEKSSGAWLVDARDGRRYLDFYTFYASSPLGMNPFA
DDPEFLAYLGRVAANKPANSDMYTVELAEFVETFQRVLGDPELPHLFFVEGGALAVENAL
KCAFDWKSRWNEAHGRDPALGTKVLHLTRAFHGRSGYTLSLTNTDPVKTERFPKFGWPRI
EVPAIHFGDVEEAERRALAQAREAFERFPHDIACFIAEPIQGEGGDNHMRPEFLQAMQAL
CHEYEALFIVDEVQTGVGLTGTPWAYQQLGLEPDIVAFAKKVQVGGIMAGRRVDLVPDNV
FRVSSRINSTWGGGLVDMVRSRRILEIIERDGLIPRAGILGEKLLGMLKSLEAEGLVSNA
RGRGLMCAFDVPDNRDVITRLREEEGILMLPCGERSVRLRPPLNIEPEELEHGIAGLRKV
LASR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atggaccccagcgctgtacacgagaccctcgcgcggcatctgctcgtcgacgggttcgat
ctggtgctcgacctggagaagagctccggagcctggctggtcgacgcgagggacggccgg
cgctacctggacttctacaccttctacgcctcgtcgccgctcggcatgaatccgttcgcc
gacgacccggagttcctcgcctacctcggccgggtcgcggcgaacaagcccgccaactcg
gacatgtacacggtcgagctcgccgagttcgtcgagacgttccagcgggtgctcggtgac
cccgagctcccccacctcttcttcgtcgagggcggcgcgctcgccgtggagaacgcgctc
aagtgcgcgttcgactggaagagccggtggaacgaggcccacggccgcgaccccgcgctc
ggcaccaaggtgctccacctcacccgggccttccacggccgcagcgggtacacgctctcg
ctcaccaacaccgacccggtgaagaccgagcggttcccgaagttcggctggccgcggatc
gaggtgccggcgatccacttcggcgacgtggaggaggcggagcggcgcgccctcgcgcag
gccagggaggcgttcgagaggttcccccacgacatcgcgtgcttcatcgccgagcccatc
cagggcgagggcggcgacaaccacatgcggccggagttccttcaggcgatgcaggcgctc
tgccacgagtacgaggccctgttcatcgtggacgaggtgcagaccggcgtcgggctcacc
gggacgccgtgggcctaccagcagctcggcctcgagccggacatcgtggccttcgccaag
aaggtccaggtcggcgggatcatggcggggcgccgggtcgacctcgtcccggacaacgtg
ttccgggtgagcagccggatcaactccacctggggcggcgggctcgtcgacatggtgcgg
tcccgccggatcctcgagatcatcgagcgggacggcctgatcccgcgggccggcatcctc
ggggagaagctcctcgggatgctcaagagcctggaggcggagggtctcgtcagcaacgcc
cggggccgcgggctcatgtgcgccttcgacgtcccggacaaccgggacgtgatcacccgg
ctccgggaggaggagggcatcctcatgctcccctgcggggagcggtcggtacggctccgc
ccgccgctgaacatcgagcccgaggagctcgagcacggcatcgccggtctgcggaaggtc
ctcgcctcccgctga

DBGET integrated database retrieval system