KEGG   Thermobispora bispora: Tbis_2830Help
Entry
Tbis_2830         CDS       T01236                                 

Definition
family 6 glycoside hydrolase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
tbi  Thermobispora bispora
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tbis_2830
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Tbis_2830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3314523..3315893
Genome map
AA seq 456 aa AA seqDB search
MSRIRRFLATALAAATAGVGAIVTAIASAGPAHAYDSPFYVDPQSNAAKWVAANPNDPRT
PVIRDRIAAVPTGRWFANYNPSTVRAEVDAYVGAAAAAGKIPIMVVYAMPNRDCGGPSAG
GAPNHTAYRAWIDEIAAGLRNRPAVIILEPDALPIMTNCMSPSEQAEVQASMAYAGKKFK
AASSQAKVYFDAGHDAWVPADEMASRLRGADIANSADGIALNVSNYRYTSGLISYAKSVL
SAIGASHLRAVIDTSRNGNGPLGSEWCDPPGRATGTWSTTDTGDPAIDAFLWIKPPGEAD
GCIATPGVFVPDRAYELAMNAAPPTYSPSPTPSSPSPSPSQSDPGSPSPSPSQPPAGKAC
EATYALVNQWPGGFQAEVTVKNTGSSPINGWTVQWTLPSGQSITQLWNGDLSTSGSNVTV
RNVSWNGNVPAGGSTSFGFLGSGTGQLSSSITCSAS
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaataaggcgctttttggccacagcgctcgccgcggccaccgccggcgtgggg
gcgatcgtcaccgccatcgcctcggccggccccgctcacgcctatgactcgcccttctac
gtggacccgcagagcaacgcggccaagtgggtggcggccaaccccaacgacccccggacg
ccggtgatccgggaccggatcgccgcggtgccgaccggccgctggttcgccaactacaac
ccctcgaccgtgcgcgccgaggtcgacgcgtacgtcggcgccgcggccgcggccgggaag
atcccgatcatggtcgtgtacgccatgccgaaccgggactgcggcgggccgagcgcgggc
ggtgcccccaaccacaccgcctaccgcgcctggatcgatgagatcgccgccggcctccgc
aaccgcccggccgtgatcatcctggagccggacgcgctcccgatcatgaccaactgcatg
agccccagcgagcaggccgaggtccaggcctccatggcgtacgcgggcaagaagttcaag
gccgcctcgtcgcaggcgaaggtctacttcgacgccggccacgacgcctgggtcccggcg
gacgagatggcctcccgcctcaggggcgccgacatcgccaacagcgcggacggcatcgcg
ctcaacgtctccaactaccggtacacctcgggcctgatctcgtacgccaagagcgtcctc
tcggcgatcggcgcgtcgcacctgcgcgcggtcatcgacaccagccggaacggcaacggc
ccgctcggcagcgagtggtgcgacccgccgggccgcgccaccggcacctggagcaccacg
gacaccggcgacccggcgatcgacgccttcctgtggatcaagccgccgggtgaggccgac
gggtgcatcgccacgccgggtgtcttcgtcccggaccgggcctacgagctcgccatgaac
gcggcgccgcccacgtacagcccgtcgcccacgccgagcagcccctccccctcgccgtcc
cagagcgacccgggttcgccctcgccgtcgccgtcccagccgccggcgggcaaggcgtgc
gaggccacgtacgcgctggtcaaccagtggccgggcggcttccaggccgaggtgaccgtg
aagaacaccggctcctcgccgatcaacgggtggaccgttcagtggaccctgccgagcggc
cagtccatcacccagctgtggaacggtgacctgtccaccagcggctcgaacgtcaccgtc
cggaacgtgagctggaacggcaacgtgccggccggcggctccacctcgttcggcttcctc
ggctcgggcaccggccagctctcctcctccatcacctgctcggcgagctga

DBGET integrated database retrieval system