KEGG   Thermobispora bispora: Tbis_3165Help
Entry
Tbis_3165         CDS       T01236                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tbi  Thermobispora bispora
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tbis_3165
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tbis_3165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3716878..3717849)
Genome map
AA seq 323 aa AA seqDB search
MPAANRHVGEIRTPSTALGGVTVRVPAKVNLQLAVGPLREDGYHDLVNVFHAVSLFDEVT
ATEPADPGAGPITVKVLGESADEVPLGEDNLAVRAAKALAAAAGRTYRADLLIRKTIPVA
GGMAGGSADAAGALVACNELWGLGLPREDLMEIAADLGSDVPFALLGGTAIGTGRGERLT
PLETSGTFHWVFALAEGGLSTPRVYGECDRLRAAAEAGVPEPAASEPLLAALRTGDAEAL
GRALANDLQPAALSLRPDLARTLDAGRALGALGAIVSGSGPTCAFLARSGEHAAELATRL
ADSGVCRSAVTAVGPVEGAALVP
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtgcctgctgcgaaccgacacgtcggcgagatccggaccccgtccaccgcgctcggcggg
gtgaccgtgcgcgtgcccgccaaggtgaacctgcagctcgccgtgggcccgctccgggag
gacggctaccacgacctggtcaacgtgttccacgccgtctccctcttcgacgaggtgacg
gccaccgagccggccgatccgggcgccgggccgatcacggtgaaggtgctcggcgagtcc
gccgatgaggtgccgctcggcgaggacaacctcgcggtccgggcggcgaaggcgctcgcc
gcggcggccgggcgcacctaccgcgccgacctgctgatccgcaagacgatcccggtggcc
ggcggcatggccggggggagcgcggacgcggccggcgccctggtcgcctgcaacgagctg
tggggcctcggcctgccccgcgaggacctcatggagatcgccgcggacctcggcagcgat
gttccgttcgcgctgctcggcggcaccgcgatcggcacgggccggggggagcggctgacc
ccgctggagacctccgggacgttccactgggtgttcgcgctcgccgagggcgggctgtcg
acgccccgggtgtacggcgagtgcgaccggctccgcgccgccgccgaggcgggggtgccg
gagccggcggcgagcgagccgctgctggccgcgctccgcaccggcgacgccgaagcgctg
ggccgcgccctcgccaacgacctgcagccggccgcgctctcgctccgcccggacctcgcc
cgcacgctcgatgccggccgggcgctcggcgcgctcggcgcgatcgtctccggttccggg
ccgacctgcgcgttcctcgcgcgctccggggagcacgcggccgagctcgccacccggctc
gccgactccggggtctgccgttccgcggtgaccgccgtcgggccggtcgagggagcggcg
ctcgtcccgtga

DBGET integrated database retrieval system