KEGG   Thermobispora bispora: Tbis_3188Help
Entry
Tbis_3188         CDS       T01236                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbi  Thermobispora bispora
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tbis_3188
   00052 Galactose metabolism
    Tbis_3188
   00500 Starch and sucrose metabolism
    Tbis_3188
   00520 Amino sugar and nucleotide sugar metabolism
    Tbis_3188
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tbis_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3739410..3740315)
Genome map
AA seq 301 aa AA seqDB search
MGDFAPVTKAVVPAAGLGTRFLPATKATPKEMLPIVDKPAIQYVVEEAVSAGLLDVLVIT
GRNKRSIEDHFDVAYELEHLLRAKGDEERLSQITEPVNLATMHYVRQGEPRGLGHAVLCA
KQHVGREPFACLLGDDIIDPRDPLLKRMIEVRGTYGGSVVALMEVSPEEITRYGAAAVVP
TDEEDVVRVTDLVEKPPAGQAPSNWAVIGRYVIDPAVFEVLENTPPGRGGEIQLTDALRT
LATRGPDEGGPVHGVLFRGRRYDTGNKLDYLRTVVQFAAEREDLAPEFLPWLRRFLDQRG
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacttcgctcctgtgaccaaggccgtggtgcccgccgcgggtctcgggacccgc
ttcctgcccgcgacgaaggcgaccccgaaggagatgctgccgatcgtcgacaagccggcg
atccagtacgtcgtcgaagaggcggtctccgccggcctgctcgacgtgctcgtcatcacc
ggccgcaacaagcggtccatcgaggatcacttcgatgtagcgtacgagctggagcacctg
ctccgcgccaagggtgacgaggagcggctgtcacagatcacggagccggtcaacctggcg
accatgcactacgtacggcagggcgagccgcgcgggctgggccacgccgtgctctgcgcc
aagcagcacgtcggacgggaaccgttcgcctgcctgctcggcgacgacatcatcgacccg
cgcgaccccctcctcaagcggatgatcgaggtgcgcggcacctacggcggcagcgtcgtc
gcgctcatggaggtgtccccggaggagatcacgcggtacggcgcggccgcggtcgtgccc
accgacgaggaggacgtggtccgcgtcacggacctcgtggagaagccacccgccggccag
gccccctcgaactgggcggtgatcggccgctacgtgatcgacccggccgtgttcgaggtg
ctggagaacaccccgccgggccggggcggggagatccagctcaccgacgcgctgcgcacg
ctcgcgacgcgcggccccgacgagggcggcccggtgcacggcgtgctgttccggggccgc
cgctacgacaccggcaacaagctcgactacctgcgaacggtcgtgcagttcgcggccgaa
cgcgaggacctcgcccccgagttcctcccctggctgcgccggttcctcgaccagcgagga
ctctga

DBGET integrated database retrieval system