KEGG   Thermobispora bispora: Tbis_3188Help
Entry
Tbis_3188         CDS       T01236                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tbi  Thermobispora bispora
Pathway
tbi00040  Pentose and glucuronate interconversions
tbi00052  Galactose metabolism
tbi00500  Starch and sucrose metabolism
tbi00520  Amino sugar and nucleotide sugar metabolism
tbi01100  Metabolic pathways
tbi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tbis_3188
   00052 Galactose metabolism
    Tbis_3188
   00500 Starch and sucrose metabolism
    Tbis_3188
   00520 Amino sugar and nucleotide sugar metabolism
    Tbis_3188
Enzymes [BR:tbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tbis_3188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-ProteinID: ADG89881
JGI: Tbis_3188
UniProt: D6Y8E5
Position
complement(3739410..3740315)
Genome map
AA seq 301 aa AA seqDB search
MGDFAPVTKAVVPAAGLGTRFLPATKATPKEMLPIVDKPAIQYVVEEAVSAGLLDVLVIT
GRNKRSIEDHFDVAYELEHLLRAKGDEERLSQITEPVNLATMHYVRQGEPRGLGHAVLCA
KQHVGREPFACLLGDDIIDPRDPLLKRMIEVRGTYGGSVVALMEVSPEEITRYGAAAVVP
TDEEDVVRVTDLVEKPPAGQAPSNWAVIGRYVIDPAVFEVLENTPPGRGGEIQLTDALRT
LATRGPDEGGPVHGVLFRGRRYDTGNKLDYLRTVVQFAAEREDLAPEFLPWLRRFLDQRG
L
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgggtgacttcgctcctgtgaccaaggccgtggtgcccgccgcgggtctcgggacccgc
ttcctgcccgcgacgaaggcgaccccgaaggagatgctgccgatcgtcgacaagccggcg
atccagtacgtcgtcgaagaggcggtctccgccggcctgctcgacgtgctcgtcatcacc
ggccgcaacaagcggtccatcgaggatcacttcgatgtagcgtacgagctggagcacctg
ctccgcgccaagggtgacgaggagcggctgtcacagatcacggagccggtcaacctggcg
accatgcactacgtacggcagggcgagccgcgcgggctgggccacgccgtgctctgcgcc
aagcagcacgtcggacgggaaccgttcgcctgcctgctcggcgacgacatcatcgacccg
cgcgaccccctcctcaagcggatgatcgaggtgcgcggcacctacggcggcagcgtcgtc
gcgctcatggaggtgtccccggaggagatcacgcggtacggcgcggccgcggtcgtgccc
accgacgaggaggacgtggtccgcgtcacggacctcgtggagaagccacccgccggccag
gccccctcgaactgggcggtgatcggccgctacgtgatcgacccggccgtgttcgaggtg
ctggagaacaccccgccgggccggggcggggagatccagctcaccgacgcgctgcgcacg
ctcgcgacgcgcggccccgacgagggcggcccggtgcacggcgtgctgttccggggccgc
cgctacgacaccggcaacaagctcgactacctgcgaacggtcgtgcagttcgcggccgaa
cgcgaggacctcgcccccgagttcctcccctggctgcgccggttcctcgaccagcgagga
ctctga

DBGET integrated database retrieval system