KEGG   Thermobispora bispora: Tbis_3218Help
Entry
Tbis_3218         CDS       T01236                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tbi  Thermobispora bispora
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tbis_3218
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_3218
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tbis_3218
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tbis_3218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3771663..3772991
Genome map
AA seq 442 aa AA seqDB search
MIDLPRHWYNILADLPTPPPPPLHPGTLKPVGPDDLAPLFPMELIAQEVSTDRFIEIPED
VLDIYRLWRPTPLIRARRLERALGTPARIYYKYEGVSPSGSHKPNTAVPQAYYNAKEGIK
KLTTETGAGQWGSSLAFACAQFGLECEIWMVRSSYDQKPYRRTLMRVYGATVHASPSPVT
EAGKKILAENPDSPGSLGIAISEAVEVAAASPDARYALGSVLNHVLLHQTVIGEEALRQL
AELGETPDLIIGCTGGGSNFGGLVFPFLREKLQGKINPVIRAVEPAACPSFTRGTYAYDF
GDTAGLTPLLKMHTLGHDFVPDPIHAGGLRYHGMSPLLSHVYELGLFEAVTRNQTECFEA
GVRFARAEGIIPGPEPTHAIAETIAEALRCKETGEEKVILTALSGHGHFDLGAYDRYLSG
ELEDFTLPPERIAESLATLPKV
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgatcgacctacctcgtcactggtacaacatcctggccgacctgcccacccctcccccg
cctccactgcacccgggcaccctgaagccggtcggaccggacgatctggcgccactgttc
ccgatggagctcatcgcccaagaggtgagcaccgaccggttcatcgagatcccggaggac
gtgctcgacatctaccggctctggcggcccaccccgctgatccgggcgcggcggctcgag
cgcgccctcggcaccccggcgcggatctactacaagtacgagggcgtctccccctccggc
tcgcacaagccgaacacggccgtgccgcaggcgtactacaacgccaaggaggggatcaag
aagctcaccaccgagaccggtgccgggcagtggggctcgtcgctcgcgttcgcgtgcgcg
cagttcggcctggagtgcgagatctggatggtccgctcctcctacgaccagaagccgtac
cggcgcacgctcatgcgcgtgtacggcgcgaccgtgcacgcgagcccgtccccggtgacc
gaggcgggcaagaagatcctggcggagaacccggactccccgggcagcctcggcatcgcg
atcagtgaggcggtggaggtcgccgccgcctcgccggacgcccggtacgcgctcggcagc
gtgctcaaccacgtgctgctccaccagaccgtgatcggtgaggaggccctgcggcagctc
gcggagctcggcgagacccccgacctgatcatcggctgcaccggtggcggctccaacttc
ggcgggctggtcttcccgttcctccgggagaagctccagggcaagatcaacccggtgatc
cgggcggtcgagccggccgcgtgcccgtcgttcacccgcggcacctacgcctacgacttc
ggggacaccgcggggctgacgccgctgctcaagatgcacacgctcggccacgacttcgtg
cccgacccgatccacgccggcggccttcggtaccacgggatgtcgccgctgctctcccac
gtctacgagctcggcctgttcgaggcggtgacccggaaccagaccgagtgcttcgaggcg
ggggtgcggttcgcccgcgccgagggcatcatcccgggcccggagccgacgcacgccatc
gccgagaccatcgccgaggcgctgcgctgcaaggagaccggcgaggagaaggtgatcctt
accgcgctgtccggccacggccacttcgacctcggcgcctacgaccggtacctctccggc
gagctggaggacttcacgctgccgccggagcgcatcgcggagtccctggccaccctgccc
aaggtctga

DBGET integrated database retrieval system