KEGG   Thermobispora bispora: Tbis_3301Help
Entry
Tbis_3301         CDS       T01236                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tbi  Thermobispora bispora
Pathway
tbi00260  Glycine, serine and threonine metabolism
tbi00750  Vitamin B6 metabolism
tbi01100  Metabolic pathways
tbi01110  Biosynthesis of secondary metabolites
tbi01120  Microbial metabolism in diverse environments
tbi01230  Biosynthesis of amino acids
Module
tbi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tbis_3301
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tbis_3301
Enzymes [BR:tbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tbis_3301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADG89991
JGI: Tbis_3301
UniProt: D6Y929
Position
complement(3858730..3859980)
Genome map
AA seq 416 aa AA seqDB search
MVHVETREFGRAIGLSCRECGALEKLGPIFACSQCFGPLEVAYDFGEISREEIVSGPPNI
WRYRALLPVPPDVAEKPNLAPGWTKLVKADRLAAELGLRSLYVKDDSGNPTHSFKDRVVA
IAVEAARAFGFRTLSCSSTGNLAGAVAAAATRAGLDSCVFIPADLEAAKIVMAAVYGGRI
VGVEGSYDDVNRLCSELLGDPLGEKWGFVNVNLRPYYAEGSKTLAYEIAEQLGWRLPDQI
VIPVASGSQLTKIDKGFRELIKLGLVEDKPYRVFGAQATGCAPVARAFKAGHDVVQPVKP
DTIVKSLAIGNPADGPYVLDVVRRTSGAVEDVDDHEVVEAIRLLARTEGIFAETAGGVTV
GVLRKLLRDGRLDPDAETVVLNTGDGLKTLDVVAGQARPTAVIRPSLDALRTAFAN
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggtgcatgtcgaaacccgtgagttcggccgtgccatcggcctgtcgtgtcgtgaatgc
ggtgccctcgagaagctaggaccgatcttcgcctgctcgcagtgtttcgggccgctcgag
gtcgcctatgacttcggtgagatcagccgcgaggagatcgtctccgggcctccgaacatc
tggcggtatcgcgcgctcctcccggtgccgccggacgtcgctgagaagcccaatctcgct
cctggctggacgaagctggtcaaggcggacaggctcgccgccgaactcgggctccgctcg
ctgtatgtgaaggacgactccggcaaccccacccattcgttcaaggaccgggtggtggcg
atcgcggtcgaggcggcgcgcgccttcggcttccgcacgctctcctgctcgtccaccggg
aacctcgccggtgcggtcgcggcggcggccacccgcgccggcctggactcctgcgtgttc
atcccggcggacctcgaggccgcgaagatcgtcatggccgcggtgtacggcggccgcatc
gtcggggtcgagggctcgtacgacgacgtcaaccgcctctgctcggagctgctcggcgac
ccgctcggggagaagtggggcttcgtcaacgtcaacctgcggccctactacgccgagggg
tcgaagacgctcgcctatgagatcgccgaacagctcggctggcggctgcccgaccagatc
gtgatcccggtggcgtccgggtcgcagctcaccaagatcgacaaggggttccgcgagctc
atcaagctcgggctggtcgaggacaagccgtaccgcgtcttcggcgcccaggccaccggc
tgcgcgccggtcgcccgcgcgttcaaggcgggccacgacgtggtgcagccggtcaagccg
gacacgatcgtcaagtcgctcgcgatcgggaacccggcggacggcccgtacgtgctcgac
gtggtccggcgcacctcgggcgcggtggaggacgtcgatgatcacgaggtggtcgaggcg
atccgcctgctcgcgcgcaccgagggcatcttcgccgagacggcgggcggggtgaccgtc
ggcgtcctgcgcaagctgctccgggacggccggctcgaccccgacgccgagaccgtggtg
ctgaacacgggcgatgggctgaagaccctcgacgtggtcgccggccaggcgcgcccgacg
gcggtcatccgcccgtccctcgacgcgctccgtacggcattcgccaactga

DBGET integrated database retrieval system