KEGG   Thermobispora bispora: Tbis_3353Help
Entry
Tbis_3353         CDS       T01236                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tbi  Thermobispora bispora
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tbi00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tbi00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3927620..3929251
Genome map
AA seq 543 aa AA seqDB search
MEDLLPRPRVAERAPGAFGLSSGAAISGPAGLVDAVRLALPVLDLRPGSHAAIQVAEDPS
LGPEAYGITITAAEVRITAADRAGAHYAGQTLRQLLPAEAFRAAALPGVAWALPCGRIAD
APAFPWRGAHLDVARHFFPKREVLRLIDLLAAHKLNRLHLHLSDDQGWRVESRAYPRLHE
VGSHRDRTVTGFHGEEPAFDGIPHGGHYTLHDLAEIAAYARARAVTVVPEIDVPGHSSAI
LAAYPELGPLPEKRYRVLDRWGISPAILSPLPATVDFLATVFDEIIGALGPTPYFHIGGD
ECVLDDWAASERVRAYQAELGLDSPSELHAWFLHRLADLLAERGVRAVVWDEAFVSGRLR
PDTVVMAWRGMEVARRAAAAGHETIAAPVFPMYLDYAEASSAEEPAGLGDATTVADVAAF
APAPAEWTAEERARVIGTQFLLWSEWIPDGRTLDYRAWPRGCAAAEVAWTGHPADQGFTG
RLGAHLKRLDALGVEYRPLTGPRPWQRGGTGWRRHRPGRVRVTEVMRHLAESAAAPGSAR
PNL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggaagacctgctgccccgaccccgggtggccgagcgcgccccgggagcgttcggcctc
agctcaggcgccgcgatcagcggccccgccggcctcgtcgacgcggtacggctcgccctg
cccgtgctcgacctgcgccccggaagccacgccgccatccaggtcgccgaggacccttcg
ctcggccccgaggcgtacgggatcaccatcacggccgccgaggtgcggatcaccgccgcg
gaccgcgcgggcgcccactacgccggccagaccctgcgccagctcctgcccgcggaggcg
ttccgggcggccgcgctccccggcgtggcgtgggccctgccgtgcggccgcatcgcggac
gcccccgcgttcccctggcggggcgcccacctcgacgtggcccggcacttcttccccaag
cgggaggtgctccggctcatcgacctgctcgccgcgcacaagctcaaccggctccacctt
cacctctccgacgatcaaggctggcgggtggagagccgggcgtacccccgcctccacgag
gtcggctcccaccgggatcggacggtcaccggtttccacggcgaggagccggcgttcgac
gggatcccgcacggcggccactacacgctccacgaccttgcggagatcgccgcgtacgcg
cgggccagggcggtcaccgtcgtcccggagatcgacgtgcccgggcacagctcggcgatc
ctcgccgcctaccccgagctcgggccgctgccggagaagcggtaccgggtgctcgaccgc
tggggcatctcaccggcgatcctctccccgctcccggccacggtggacttcctcgccacg
gtcttcgacgagatcatcggtgcgctcgggcccacgccgtacttccacatcggcggggac
gagtgcgtgctcgacgactgggccgcgtccgagcgggtccgcgcctaccaggccgagctc
gggctcgacagcccgagcgagctgcacgcctggttcctccaccggctcgccgacctcctc
gccgagcgcggcgtccgggcggtggtctgggacgaggccttcgtgagcgggaggctccgg
ccggacacggtggtgatggcgtggcgcgggatggaggtcgcgcggcgcgccgcagcggcc
gggcacgagaccatcgccgcgccggtcttcccgatgtacctcgactatgccgaggcatcc
tccgccgaggagccggccgggctcggggacgccaccaccgtggccgatgtcgcggcgttc
gcgcccgccccggcggagtggacggccgaggagcgcgcccgggtgatcggcacccagttc
ctgctctggagcgagtggatcccggacggcaggaccctcgactaccgggcctggccgcgt
ggctgcgccgccgccgaggtcgcctggaccggccacccggcagatcaggggttcaccggc
aggcttggcgcccacctgaagcggctggacgcgctgggcgtggagtaccgcccgctcacc
ggcccgcggccgtggcagcggggcggcaccgggtggcggcgccaccgccccggccgggtg
cgggtcaccgaggtcatgcgccacctcgccgaatcggccgccgcacccgggtcggcccgg
ccgaacctgtga

DBGET integrated database retrieval system