KEGG   Thermobispora bispora: Tbis_3353Help
Entry
Tbis_3353         CDS       T01236                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
tbi  Thermobispora bispora
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Tbis_3353
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Tbis_3353
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Tbis_3353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3927620..3929251
Genome map
AA seq 543 aa AA seqDB search
MEDLLPRPRVAERAPGAFGLSSGAAISGPAGLVDAVRLALPVLDLRPGSHAAIQVAEDPS
LGPEAYGITITAAEVRITAADRAGAHYAGQTLRQLLPAEAFRAAALPGVAWALPCGRIAD
APAFPWRGAHLDVARHFFPKREVLRLIDLLAAHKLNRLHLHLSDDQGWRVESRAYPRLHE
VGSHRDRTVTGFHGEEPAFDGIPHGGHYTLHDLAEIAAYARARAVTVVPEIDVPGHSSAI
LAAYPELGPLPEKRYRVLDRWGISPAILSPLPATVDFLATVFDEIIGALGPTPYFHIGGD
ECVLDDWAASERVRAYQAELGLDSPSELHAWFLHRLADLLAERGVRAVVWDEAFVSGRLR
PDTVVMAWRGMEVARRAAAAGHETIAAPVFPMYLDYAEASSAEEPAGLGDATTVADVAAF
APAPAEWTAEERARVIGTQFLLWSEWIPDGRTLDYRAWPRGCAAAEVAWTGHPADQGFTG
RLGAHLKRLDALGVEYRPLTGPRPWQRGGTGWRRHRPGRVRVTEVMRHLAESAAAPGSAR
PNL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggaagacctgctgccccgaccccgggtggccgagcgcgccccgggagcgttcggcctc
agctcaggcgccgcgatcagcggccccgccggcctcgtcgacgcggtacggctcgccctg
cccgtgctcgacctgcgccccggaagccacgccgccatccaggtcgccgaggacccttcg
ctcggccccgaggcgtacgggatcaccatcacggccgccgaggtgcggatcaccgccgcg
gaccgcgcgggcgcccactacgccggccagaccctgcgccagctcctgcccgcggaggcg
ttccgggcggccgcgctccccggcgtggcgtgggccctgccgtgcggccgcatcgcggac
gcccccgcgttcccctggcggggcgcccacctcgacgtggcccggcacttcttccccaag
cgggaggtgctccggctcatcgacctgctcgccgcgcacaagctcaaccggctccacctt
cacctctccgacgatcaaggctggcgggtggagagccgggcgtacccccgcctccacgag
gtcggctcccaccgggatcggacggtcaccggtttccacggcgaggagccggcgttcgac
gggatcccgcacggcggccactacacgctccacgaccttgcggagatcgccgcgtacgcg
cgggccagggcggtcaccgtcgtcccggagatcgacgtgcccgggcacagctcggcgatc
ctcgccgcctaccccgagctcgggccgctgccggagaagcggtaccgggtgctcgaccgc
tggggcatctcaccggcgatcctctccccgctcccggccacggtggacttcctcgccacg
gtcttcgacgagatcatcggtgcgctcgggcccacgccgtacttccacatcggcggggac
gagtgcgtgctcgacgactgggccgcgtccgagcgggtccgcgcctaccaggccgagctc
gggctcgacagcccgagcgagctgcacgcctggttcctccaccggctcgccgacctcctc
gccgagcgcggcgtccgggcggtggtctgggacgaggccttcgtgagcgggaggctccgg
ccggacacggtggtgatggcgtggcgcgggatggaggtcgcgcggcgcgccgcagcggcc
gggcacgagaccatcgccgcgccggtcttcccgatgtacctcgactatgccgaggcatcc
tccgccgaggagccggccgggctcggggacgccaccaccgtggccgatgtcgcggcgttc
gcgcccgccccggcggagtggacggccgaggagcgcgcccgggtgatcggcacccagttc
ctgctctggagcgagtggatcccggacggcaggaccctcgactaccgggcctggccgcgt
ggctgcgccgccgccgaggtcgcctggaccggccacccggcagatcaggggttcaccggc
aggcttggcgcccacctgaagcggctggacgcgctgggcgtggagtaccgcccgctcacc
ggcccgcggccgtggcagcggggcggcaccgggtggcggcgccaccgccccggccgggtg
cgggtcaccgaggtcatgcgccacctcgccgaatcggccgccgcacccgggtcggcccgg
ccgaacctgtga

DBGET integrated database retrieval system