KEGG   Thermobispora bispora: Tbis_3446Help
Entry
Tbis_3446         CDS       T01236                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
tbi  Thermobispora bispora
Pathway
tbi00790  Folate biosynthesis
tbi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tbis_3446
Enzymes [BR:tbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Tbis_3446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADG90135
JGI: Tbis_3446
UniProt: D6Y9V4
Position
complement(4021223..4021807)
Genome map
AA seq 194 aa AA seqDB search
MTVPPPNFDRARIERAVREILIGIGEDPDREGLRDTPARVARAYAEQFSGLGQRPEDALT
TMFDADHDEMVLVKDIEVMSMCEHHLLPFYGVAHIGYTPNEKGKVTGLSKLARLVDVYAR
RPQLQERMTSQIADGLMQVLEPRGVIVVIEAEHMCMTMRGVRKPGAKTITSAVRGDFRTC
EATRAEAMSLILRR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
gtgacggttccccctccgaacttcgatcgtgcgcgcatcgagcgggccgtccgcgagatc
ctcatcgggatcggtgaggatcccgaccgtgagggcctccgggacaccccggcccgggtc
gcgcgagcgtacgccgagcagttctccggcctcggccagcggcccgaggacgcgctgacc
acgatgttcgacgcggaccacgacgagatggtcctggtcaaggacatcgaggtcatgtcg
atgtgcgagcaccacctcctgccgttctacggcgtggcgcacatcgggtacaccccgaac
gagaaggggaaggtcacgggcctgtcgaagctggcgaggctggtggacgtctacgcccgc
cgccctcagctccaggagcggatgacctcgcagatcgccgacggcctgatgcaggtgctc
gagccccgcggggtgatcgtggtgatcgaggccgagcacatgtgcatgaccatgcgcggg
gtgcgcaagcccggggccaagacgatcacctcggcggtgcgcggcgacttccgcacctgc
gaggcgacccgcgccgaggccatgtcgctcatcctgcggaggtga

DBGET integrated database retrieval system