KEGG   Thermobispora bispora: Tbis_3504Help
Entry
Tbis_3504         CDS       T01236                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
tbi  Thermobispora bispora
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:tbi00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4089608..4091926)
Genome map
AA seq 772 aa AA seqDB search
MEEIASIDAYWRAANYLSVGQIYLLDNPLLREPLRPEHIKPRLLGHWGTVPGINFCFAHL
NRIIRRRDQDMIYICGPGHGGPAVVAHSWLEGTYTERYPHITQDAKGMRLLFRQFSFPGG
VPSHAAPETPGSIHEGGELGYSLAHAYGAAFDNPGLVVACIIGDGEAETGPLAASWHSNK
FLTPGRDGVVLPILHLNGYKIANPTVLARIPEPELVKLLEGYGYRVHIVAGDDPAELHPL
MARTLDEVFAEIDEYTAGRERRLPMIVLRTPKGWTGPREVDGVPVEGTWRSHQVPLAQVR
TSPEHLRMLEEWMRSYRPEELFDAEGRPTPLVLGEVPEGERRMSANPHANGGELLVPLVL
PDFRDYAVPVKEPAVTCSEPTRVLGSYLRDVIAANPRNFRLMGPDETASNRLSAVFEATD
KAWDAAVLGTDEHLSREGRVMEVLSEHLCQGWLEGYLLTGRHGLFNCYEAFIHIVDAMFN
QHAKWLESAKKIPWRRPVASLNYLLTSHVWRQDHNGFSHQDPGFLDVVVNKKADVVRVYL
PPDTNTLLSVADHCLRSRDYVNVIVVGKQPVLDLMSMDEAIAHCTRGAGILRWASTDEGA
EPDVVLACAGDVPTMETLAAAALLRAHLPELRVRVVNVVDLMCLQPPSEHPHGLSDHEFD
ALFTTDKPIIFNFHGYPWLIHRLTYRRNGHDNLHVRGYKEEGTTTTPFDMAMMNDIDRFH
LVMDVIDRVPGLRTTASHLRQAMVDARLRARAYTRDHGEDPPEIRDWTWPYD
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
gtggaggaaatcgcgagcatcgatgcctactggagagcggcgaactacctgtccgtcggg
cagatctacctgctcgacaacccgctgctccgcgagccgctgcggcccgagcacatcaag
ccccggctgctcggccactggggcaccgtgccggggatcaacttctgcttcgcccacctc
aaccggatcatccgccggcgcgaccaggacatgatctacatctgcggtcccgggcacggc
gggccggccgtggtggcgcactcctggctggagggcacctacacggagcggtacccgcac
atcacccaggacgccaaggggatgcggctgctgttccggcagttctccttccccggcggc
gtgcccagccacgccgcgccggagacgcccggctccattcacgagggcggtgagctcggc
tactccctcgcccacgcgtacggcgccgcgttcgacaaccccgggctggtggtcgcctgc
atcatcggcgacggggaggcggagaccgggccgctcgccgcgagctggcactcgaacaag
ttcctcaccccaggccgggacggggtggtgctgccgatcctgcacctgaacgggtacaag
atcgcgaacccgacggtgctggcgcgcatcccggagccggagctggtcaagctcctcgag
gggtacgggtaccgggtgcacatcgtcgccggggacgacccggcggagctgcacccgctg
atggcccggaccctggacgaggtcttcgcggagatcgacgagtacaccgcggggcgggag
cgccggctcccgatgatcgtgctgcgcacgcctaaggggtggaccggcccgcgggaggtg
gacggggtgccggtggagggcacctggcgatcccaccaggtgccgctcgcccaggtccgc
accagccccgagcacctgcgcatgctggaggagtggatgcgctcctaccggccggaggag
ctgttcgacgccgagggacggcccaccccgctggtcctcggcgaggtgcccgagggcgag
cggcggatgagcgcgaacccgcacgccaacggcggcgagctgctcgtgccgctggtgctg
cccgacttccgcgactacgcggtgccggtgaaggagcccgcggtgacctgcagcgagccc
acccgggtgctggggagctacctgcgggacgtgatcgcggccaacccgcgcaacttccgg
ctgatgggcccggacgagaccgcgtccaaccggctctccgccgtgttcgaggcgaccgac
aaggcctgggacgccgccgtgctcggcaccgacgagcacctgtcccgggagggccgggtg
atggaggtgctgagcgagcacctctgccagggctggctcgagggctacctgctcaccggg
cggcacggcctgttcaactgctacgaggcgttcatccacatcgtggacgccatgttcaac
cagcacgccaagtggctggagtcggcgaagaagatcccctggcggcggccggtggcgtcg
ctcaactacctgctcacctcgcacgtgtggcggcaggaccacaacgggttcagccaccag
gacccgggcttcctcgacgtggtggtgaacaagaaggccgacgtggtcagggtctacctg
ccgccggacaccaacaccctgctctcggtcgctgaccactgcctgcgctcgcgggactac
gtcaacgtgatcgtggtgggcaagcagcccgtgctcgacctgatgagcatggacgaggcg
atcgcccactgcacccggggcgccggcatcctgcgctgggcctccaccgatgagggggcc
gagccggacgtggtgctcgcgtgcgccggggacgtcccgacgatggagacgctcgccgcc
gccgcgctgctccgcgcccacctgcccgagctgcgggtccgggtggtgaacgtggtcgac
ctgatgtgcctgcagccgccctcggagcacccgcacggcctgtccgaccacgagttcgac
gccctgttcaccacggacaagccgatcatcttcaacttccacggctacccgtggctcatc
caccggctcacctaccggcggaacggccacgacaacctgcacgtgcggggctacaaggag
gagggcaccacgaccacgcccttcgacatggcgatgatgaacgacatcgaccggttccac
ctggtcatggacgtgatcgaccgcgtgcccggcctgcgcaccaccgcgagccacctccgg
caggcgatggtcgacgcccggctgcgggcccgggcgtacacccgcgatcacggcgaggac
ccgccggagatccgcgattggacctggccctacgactga

DBGET integrated database retrieval system