KEGG   Thermobispora bispora: Tbis_3530Help
Entry
Tbis_3530         CDS       T01236                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tbi  Thermobispora bispora
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tbis_3530
DNA repair and recombination proteins [BR:tbi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tbis_3530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4122041..4122640)
Genome map
AA seq 199 aa AA seqDB search
MYEGVLQNLIDELGRLPGIGPKSAQRIAFHILGADPVDVKRLAQALLEVKEKIHFCRICG
NVATEDECLICRDPRRDDQVICVVEEPKDVVAIERTREFRGRYHVLGGAISPIDGIGPDD
LRIRELMARLADGQVNELILATDPNLEGEATATYLARLVKPLGIKVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLLDV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgtacgaaggggttctgcagaacctgatcgacgagctggggcgccttcccggcatcggg
ccgaagagcgcgcagcgcatcgccttccacatcctcggcgccgatccggtggacgtgaaa
cggctggcgcaggcgctgctcgaggtcaaggagaagatccatttctgccgtatctgcggg
aacgtcgccaccgaggacgagtgcctgatctgccgtgacccgcggcgggacgaccaggta
atctgcgtggtcgaggaaccgaaggacgtcgtcgcgatcgaacggacccgggagttccgc
ggccgctaccacgttctcggcggggcgatcagcccgatcgacggcatcgggccggatgac
ctgaggatccgcgagctgatggcccggctcgccgacggccaggtcaacgagctgatcctc
gcgaccgacccgaacctcgagggggaggcgacggccacctacctggcgcggctggtcaag
cccctcgggatcaaggtgacgcgactggccagcggtctgccggttggcggtgacctcgag
tatgccgacgaggtcaccttgggccgcgctttcgaaggacggaggctgctggatgtctga

DBGET integrated database retrieval system