KEGG   Tetrapisispora blattae: TBLA_0A01010Help
Entry
TBLA_0A01010      CDS       T02489                                 

Gene name
TBLA0A01010
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:tbl04141]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:229141..231228
Genome map
AA seq 695 aa AA seqDB search
MKLLTLLYSIILLGFSLAENDEENSEPLPPPLTAENFEETLKTGLHIVEFFSPYCSHCKQ
LAPIWKDTWNAFHKEGESLNITFSQVDCIASGDLCSKEEITSYPTIKLYSKNGFIKDYPD
EHGYERTKEDFIKFARESVFENPDFDVLQLEGDSEYITNLEMISLLSGLEDLPYLVSFWP
THKLKKMTDEVEYKYCKDCEPFQETWMKITKELLPKGILTAHFNCEEYPKICSEIGFPEL
AEVPEIPAGRGPRIALFLPDKDHNNLFVYRKKFTHVVEDYVDFAIRTYKNSMLPTFSPSR
IFEIISKDNKLEHNGATNNKVHVVFAYNKETVVDEDFHILEYLIEPLSLIPNLYLYKTED
DLMFASREGFRAFYNNLETDMEGNKIEPNEEYFMMASMTQYPTFYLFREGDRIPHVYHGY
SSTEMRDYNQIMHWVYGNSYPYVEEIDYRRFEEKMNFRNDEYSYMLLQFVDMSNDEKLRE
SSENLNNLVKASLNHEAKRIEAIMKEIDRKRDKKVHLVQKLKDQNAEIKKINAVRNSEIT
HENNKKTLITYIDLSKHDYFTINTGLDRTNHQFEIGDVVILDKKRRKYYTLDITGEQLTS
KNKDMVEKTLTALNLPKMTEFKLLDKGHYLKSNVNYDINYFLSIPHIHWYIACVAFVVIT
VYFKNKSTVVKRYSRGRYSNLNQAPPSPRKGEFQD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgaaactattgacacttctttactcaatcattttactaggattctccttagctgaaaat
gacgaggagaattctgagccacttcctccacctctaactgctgagaattttgaagaaaca
ctcaaaactggtttacatatcgttgagttttttagtccttattgctcgcattgtaagcag
ttggctccaatctggaaggatacttggaacgcatttcacaaggaaggggaaagtttaaac
attactttttcacaagttgactgcattgctagtggtgatctctgctcaaaagaagaaatc
acttcttatcctactataaaactttacagcaaaaatggctttattaaagactatccagac
gagcatggttacgaaaggaccaaagaagatttcattaaatttgctcgtgaatctgttttc
gagaatcctgattttgatgttttgcagttagaaggtgatagtgaatatataactaatttg
gaaatgattagtttactatctggtttggaagatttgccctatctagtttcattctggcca
acccacaaactaaagaagatgacagacgaagtagaatataaatattgtaaggattgtgaa
cctttccaagaaacttggatgaaaattactaaagaacttttaccaaagggtattttaacc
gctcattttaattgtgaggaatatccaaaaatttgttctgaaattggtttcccagagctc
gcagaagttccagaaattcctgcaggtagaggtccaagaattgcattatttttgccagat
aaagaccataataacctatttgtttatcgtaaaaagttcactcatgtggttgaagattat
gtagatttcgctatacgaacttataaaaatagtatgcttccaactttttcaccttcaaga
atatttgaaatcatatctaaagataataaactagaacacaatggtgcaaccaataataaa
gtacatgttgtatttgcctataataaagaaactgtcgttgatgaagatttccatatatta
gaatacttaatcgaaccgctgtctctaattccgaacctttatttgtataaaacagaagat
gatttaatgtttgctagtcgtgaaggtttccgtgcattttataataatttagaaactgat
atggagggaaataagattgagcctaacgaagaatatttcatgatggcatccatgactcaa
tatcctacattttatttgtttagagaaggagataggattccacacgtttaccatggatat
tcttcaacagaaatgagagattataatcaaattatgcattgggtttatggaaactcatac
ccttatgtggaagaaatagactacaggaggtttgaagagaagatgaattttagaaatgat
gaatatagttacatgttacttcagtttgttgatatgtcaaatgatgaaaaattaagagaa
agctcagagaatcttaataatcttgtaaaagcatcattaaatcatgaagctaaaagaatc
gaagctattatgaaagaaattgatcggaagagagataaaaaagttcatttagttcaaaaa
ttgaaagatcaaaatgcggaaataaaaaaaataaatgctgtcagaaatagtgaaattact
catgagaataataaaaaaacgttgataacatatattgacctttccaaacatgattatttc
acgatcaatactggtctagacagaactaatcaccagtttgaaattggtgatgttgtcata
cttgataagaaaagacgtaaatattatactctggatattactggtgagcaactaacgagt
aaaaataaagatatggtcgaaaagacattgacagctttaaacttaccaaaaatgactgag
tttaaactacttgataaaggacattatctaaaatcgaacgtaaattatgacataaattac
tttctttctattcctcacatccattggtatatcgcatgtgttgcatttgtggtaattaca
gtttatttcaaaaataaatccacagttgtaaaaagatattcacgtggtcgctattctaat
ttgaatcaagctccaccatctccacgtaagggcgaattccaagactaa

DBGET integrated database retrieval system