KEGG   Tetrapisispora blattae: TBLA_0A02920Help
Entry
TBLA_0A02920      CDS       T02489                                 

Gene name
TBLA0A02920
Definition
(RefSeq) hypothetical protein
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tbl  Tetrapisispora blattae
Pathway
tbl00330  Arginine and proline metabolism
tbl00332  Carbapenem biosynthesis
tbl01100  Metabolic pathways
tbl01130  Biosynthesis of antibiotics
tbl01230  Biosynthesis of amino acids
Module
tbl_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TBLA_0A02920 (TBLA0A02920)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    TBLA_0A02920 (TBLA0A02920)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TBLA_0A02920 (TBLA0A02920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Nucleotid_trans
Motif
Other DBs
NCBI-GeneID: 14492888
NCBI-ProteinID: XP_004177611
UniProt: I2GVE0
Position
1:complement(701971..703248)
Genome map
AA seq 425 aa AA seqDB search
MDTDKSYTIVLKLGSSSLVASDSREPRLALMSKVVETVVALRRQGHKVVIVSSGGIAVGL
RTLEMDKTQTLIRDSSCISSSQGRLIARWDRLFSFFDQRIAQILLTRNDIVDWSQYKNAQ
GTIHELLKMGVVPIINENDTLSARDIRFGDNDTLSAIAASLVNADYLFLMTDVDCLYTDD
PRSNPDAKPILIVPDLSQGLPGVETSGGSGSDVGTGGMRTKLVAAELATTAGVHTIVMKS
DVPENVYKIVEYMQSTDLDGQRQKYDGDIMEVQDAELKRLQELDVPLHTKFVANDVKHLL
KDRDFWILHGLVANGSVVIDEGAYKALTRKNKAGLLPVGIIAIEGSFHEFECVDLKYGKR
LKNGEVDPNFPLITFGRARCNYSSTELEKIKGLQSDQIDSILGYLDSEYVAERQNIAFPP
TEFEV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacacagataaatcatataccattgtattaaaacttggctcttcatcattagtagct
tcagattctcgagagccaagattggctttgatgtctaaagttgttgagacagttgtagca
ttaagaagacaaggacataaagtggtaattgtctctagtggtggtattgctgttggatta
agaactttagagatggataaaacccaaacacttatcagagattcaagctgtatcagcagt
agtcaaggtagattaattgctagatgggatcgattattttcatttttcgatcaaagaatt
gcacaaatcttattaacaagaaatgatattgttgattggtctcaatataagaatgctcaa
ggaacaatacatgaacttttaaaaatgggggttgtcccaattattaatgaaaatgatact
ttatcagcaagagatattagatttggtgataatgatacgttatctgctattgcagcatcg
ttagttaatgcggattatttatttttaatgacagatgtggattgtttgtatacggatgat
ccaagatcaaatccagatgccaaaccaattttaattgttccagatttatcacaagggtta
cctggtgtggagacttcaggtgggtctggttcagatgtggggactggtggtatgagaacc
aaattggttgctgccgaattggcaacaacagctggtgttcatacgattgttatgaaaagt
gatgttccagagaatgtttacaagattgttgaatatatgcaatctactgatttagatgga
caacgtcaaaaatatgatggagatataatggaagtccaagatgcagaattgaaaagatta
caagaattggatgttccacttcatacgaaatttgtggctaatgatgtgaaacatttgttg
aaagatcgagatttctggatcttacatgggttggttgctaatggatctgtggtgattgat
gaaggtgcatataaggccttaacaaggaaaaacaaagctgggttattaccagtggggatc
attgccattgaaggatcattccatgaatttgaatgtgttgatttgaaatatggtaagaga
ttaaagaatggagaagtggatccaaatttcccattgattacgtttgggagagccagatgt
aattattcaagtactgaattggaaaagattaaaggtttacaaagtgatcaaatcgattct
atattgggatatttagatagtgaatatgttgctgaaagacaaaacattgcgttcccacca
actgagtttgaagtgtag

DBGET integrated database retrieval system