KEGG   Tetrapisispora blattae: TBLA_0A02920Help
Entry
TBLA_0A02920      CDS       T02489                                 

Gene name
TBLA0A02920
Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tbl  Tetrapisispora blattae
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TBLA_0A02920 (TBLA0A02920)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TBLA_0A02920 (TBLA0A02920)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     TBLA_0A02920 (TBLA0A02920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(701971..703248)
Genome map
AA seq 425 aa AA seqDB search
MDTDKSYTIVLKLGSSSLVASDSREPRLALMSKVVETVVALRRQGHKVVIVSSGGIAVGL
RTLEMDKTQTLIRDSSCISSSQGRLIARWDRLFSFFDQRIAQILLTRNDIVDWSQYKNAQ
GTIHELLKMGVVPIINENDTLSARDIRFGDNDTLSAIAASLVNADYLFLMTDVDCLYTDD
PRSNPDAKPILIVPDLSQGLPGVETSGGSGSDVGTGGMRTKLVAAELATTAGVHTIVMKS
DVPENVYKIVEYMQSTDLDGQRQKYDGDIMEVQDAELKRLQELDVPLHTKFVANDVKHLL
KDRDFWILHGLVANGSVVIDEGAYKALTRKNKAGLLPVGIIAIEGSFHEFECVDLKYGKR
LKNGEVDPNFPLITFGRARCNYSSTELEKIKGLQSDQIDSILGYLDSEYVAERQNIAFPP
TEFEV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacacagataaatcatataccattgtattaaaacttggctcttcatcattagtagct
tcagattctcgagagccaagattggctttgatgtctaaagttgttgagacagttgtagca
ttaagaagacaaggacataaagtggtaattgtctctagtggtggtattgctgttggatta
agaactttagagatggataaaacccaaacacttatcagagattcaagctgtatcagcagt
agtcaaggtagattaattgctagatgggatcgattattttcatttttcgatcaaagaatt
gcacaaatcttattaacaagaaatgatattgttgattggtctcaatataagaatgctcaa
ggaacaatacatgaacttttaaaaatgggggttgtcccaattattaatgaaaatgatact
ttatcagcaagagatattagatttggtgataatgatacgttatctgctattgcagcatcg
ttagttaatgcggattatttatttttaatgacagatgtggattgtttgtatacggatgat
ccaagatcaaatccagatgccaaaccaattttaattgttccagatttatcacaagggtta
cctggtgtggagacttcaggtgggtctggttcagatgtggggactggtggtatgagaacc
aaattggttgctgccgaattggcaacaacagctggtgttcatacgattgttatgaaaagt
gatgttccagagaatgtttacaagattgttgaatatatgcaatctactgatttagatgga
caacgtcaaaaatatgatggagatataatggaagtccaagatgcagaattgaaaagatta
caagaattggatgttccacttcatacgaaatttgtggctaatgatgtgaaacatttgttg
aaagatcgagatttctggatcttacatgggttggttgctaatggatctgtggtgattgat
gaaggtgcatataaggccttaacaaggaaaaacaaagctgggttattaccagtggggatc
attgccattgaaggatcattccatgaatttgaatgtgttgatttgaaatatggtaagaga
ttaaagaatggagaagtggatccaaatttcccattgattacgtttgggagagccagatgt
aattattcaagtactgaattggaaaagattaaaggtttacaaagtgatcaaatcgattct
atattgggatatttagatagtgaatatgttgctgaaagacaaaacattgcgttcccacca
actgagtttgaagtgtag

DBGET integrated database retrieval system