KEGG   Tetrapisispora blattae: TBLA_0A04000Help
Entry
TBLA_0A04000      CDS       T02489                                 

Gene name
TBLA0A04000
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
tbl  Tetrapisispora blattae
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TBLA_0A04000 (TBLA0A04000)
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     TBLA_0A04000 (TBLA0A04000)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:994792..996678
Genome map
AA seq 628 aa AA seqDB search
MVSDHPMSKSRSSNIPGATSPRRPGLTKQTSLTRLTRTISVESTFSMASIENATSNLTPG
KLTNRSLDDLTESLTKLGIAGNLTSILSQEIHRQDLSAASGNNQGTSTSSDKEKDRDSLE
VPFINISLDASLPHDYFKDDVLNTIQALHIKHWYVKNVPNQSISPLDRKKIDLTRITGAM
TNVIYKVEYPELPSLLLRVYGPNGDSIIDREYELQVLARLSSRNIGPKLFGCFENGRFEQ
YLENSTTLTKEDIRDWKTSQRIARRMKELHSGVPLLPREKLQGATVWRMIEKWFNTIESN
KTWIQSNKVQDVLLAQDWENFKKAIQSYRYWLQKNNSKIFGENLVFCHNDTQYGNLLFSS
PVTKSISTAISSPFLEPVKSSGSISSPYLTHVNSATSSVTSLFQPNVNISLDDIILPTKD
EQKQDSKLVVIDFEYAGPNPAVFDLANHLCEWMHDYNCNEPHKCFIENFPNRNQILNFLY
SYVSHLRHDKGISIDEEVRQYYNALMKWRGTVQLFWGLWAIIQSGNLSTEENNETTNDHG
NEEITVEEHGPGGAKYIIKTEEYNDEEHNEPTPPIEEVETAGVDIDSFDYLGFCKDKMSV
FWGDLISLGVVNDGYIEDSIRKLGCELV
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggtttcagatcatccaatgtctaaatcacgttcttcgaacattccaggagctacttct
ccacgtaggccaggtctaaccaagcaaacttcacttacaaggctaacaaggacaattagc
gtagaatctactttttcaatggcaagtattgaaaatgcaacttcaaatttaactccaggg
aaattgactaaccgatcattagatgatctgactgaatctttaacaaaattaggtatagct
ggaaaccttacttctattctgagtcaagaaattcataggcaagatctttctgctgcctcg
ggcaataatcaaggaactagcacatcatcagataaggaaaaggatcgtgattcattagaa
gttccttttataaatatttctttagatgcttcgttaccacatgactattttaaggatgat
gttttaaatactattcaagctttacatattaaacattggtatgttaaaaatgtaccaaat
caatctatatcaccattagataggaagaaaattgatttaactagaataacaggggctatg
accaatgttatttataaagttgaataccctgaattgccttctttattgttaagagtctat
ggccccaatggtgattcaattatcgatagagaatatgaattacaagtattagcgagatta
tcaagtagaaatattggtccaaaattatttggttgttttgaaaacggtagatttgaacaa
tatttagaaaactctacaacgttgactaaagaagatattcgcgattggaaaacttctcaa
agaatagcaagaagaatgaaagagttgcattcaggggtccctctattaccaagagaaaaa
ttacaaggtgctactgtttggagaatgattgaaaaatggttcaatacaatagaatcaaat
aaaacttggattcaatccaataaagtacaagatgtattattagctcaagattgggaaaat
tttaaaaaggccatacagtcatatagatattggctacaaaaaaataattcaaagatattt
ggagaaaatttagtattttgccataatgatacacaatatggtaatttattatttagttct
cctgttactaaatctatttctactgctatatcaagtccattcttggagcctgttaaaagt
agcggttccataagctcaccatacctaactcatgtgaattctgccacttcttctgttact
tctttatttcaaccaaatgtaaatatatctttagatgatattatcttaccaacaaaagat
gaacaaaaacaggattcgaagcttgtagtaatcgatttcgaatatgcaggtccaaatcca
gcagtctttgatttagcaaatcatttatgtgaatggatgcatgattataactgtaatgag
ccacataagtgtttcattgaaaatttcccaaatagaaaccaaattttaaactttctttat
tcatatgtttcacatctacgacatgataagggtatatccattgatgaagaagttaggcaa
tattataatgctcttatgaaatggagaggtacagtgcaattattttggggtttatgggcc
attattcagagtggtaacctctcaaccgaggaaaataacgaaactacaaatgaccatgga
aatgaagaaattactgttgaagaacatgggcctggtggagcaaaatatatcattaagaca
gaggaatataatgacgaagaacataatgaaccaactcctccaattgaagaagttgagaca
gcaggtgttgatattgactcatttgattacttagggttttgcaaagataaaatgtcagta
ttttggggtgatttgatatcactaggtgtagtaaacgacggttatattgaagattcgatt
agaaaactcggctgtgagcttgtataa

DBGET integrated database retrieval system