KEGG   Tetrapisispora blattae: TBLA_0A05040Help
Entry
TBLA_0A05040      CDS       T02489                                 

Gene name
TBLA0A05040
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
tbl  Tetrapisispora blattae
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TBLA_0A05040 (TBLA0A05040)
Enzymes [BR:tbl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TBLA_0A05040 (TBLA0A05040)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   TBLA_0A05040 (TBLA0A05040)
  Exosomal proteins of colorectal cancer cells
   TBLA_0A05040 (TBLA0A05040)
  Exosomal proteins of bladder cancer cells
   TBLA_0A05040 (TBLA0A05040)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1238821..1240473)
Genome map
AA seq 550 aa AA seqDB search
MQLSKKALFSLATLLVQALSVQAQGGEATAPEDSSVVKLNAETFNEFIKENPLVMAEFFA
PWCGHCKNLAPQYVDAAAQLESRNIPLAQVDCTENDELCLEHGIRGYPTIKVFKDGNVTH
PTDYEGQRSAGAIVKFMVKNSLPPVQVLSTQDELLAALNETVAPVIVDSGVEGYNETFYS
VAKGLSMDYTFISFPDSKAKSKLTLYLPKDQAITKDTEDILEKFEKIEFDGDFKKLVKDE
EITSNWIKAEAVPYFTDLNGDNYKSFFEAGIPLAYLFYNDEEELQQYIPIMTKISKANRG
KMNFVHLDSKRYGRFAENLNMKQQFPAFAIQDFEANLKYGLPQLSEEEFEKIKEPAQFTE
KELSKLVKDVLKGSAEPIVKSEEIPETQDSPVIKIVAKNHDEIVNDSSKDVLVKYYAPWC
GHCKRMAPVYQELADIYASDKKLKDKVVIAEMNGELNDVASVKIEGYPTLILYPAGKNSE
PVEFSGARDLETFINFIKENGKNSVDGNEALTSLREEQEKAKAKEEEEALDLDLDNDDED
VEDELENDEL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaattaagtaagaaagctttattttctctagctactttgttggttcaagccctttct
gttcaagctcaagggggtgaagccactgctccagaagattcttctgttgtcaagttaaac
gctgaaactttcaatgaatttatcaaggaaaacccattagtcatggctgaattttttgcc
ccatggtgtggtcattgtaagaacttggctccacaatacgtggatgctgctgctcaattg
gaatctagaaacatcccattggctcaagttgattgtactgaaaatgatgaattatgtttg
gaacatggtatcagaggttatccaaccattaaagttttcaaagatggtaatgtcacccat
ccaaccgattatgaaggtcaaagatctgcaggtgctattgtcaaattcatggtgaaaaac
tctttgccacctgttcaagtcttgagtactcaagatgaattattggctgctttgaatgaa
accgtcgcaccggttattgtcgattccggtgttgaaggttataatgaaactttctacagc
gttgccaagggtttaagtatggattacacttttatctcctttccagattccaaagctaaa
tccaagttaactttatatttaccaaaggatcaagctattaccaaagatactgaagatatt
ttagaaaaattcgaaaaaatcgaattcgatggtgatttcaagaaattagttaaagatgaa
gaaatcacttctaattggattaaagctgaagctgttccatatttcaccgatttaaacggt
gacaactacaaatctttctttgaagctggtatcccattagcctacttattctataacgat
gaagaagaattacaacaatatattccaatcatgaccaagatttccaaagctaaccgtggt
aagatgaatttcgtccatttggattccaagagatatggtagatttgctgaaaacttgaac
atgaaacaacaattcccagcatttgccatccaagatttcgaagccaatttgaaatatggg
ttaccacaattatctgaagaagaatttgaaaaaattaaagaacctgctcaattcactgaa
aaggaattatccaaattagttaaagatgttttgaaaggtagcgctgaaccaattgtcaaa
tccgaagaaatcccagaaactcaagattctcctgttattaagattgttgccaagaaccat
gatgaaattgttaatgattcttccaaggatgtcttggttaaatactatgctccatggtgt
ggtcattgtaagagaatggctccagtttatcaagaattagctgatatttatgcatctgac
aagaaattaaaagataaagttgtcattgctgaaatgaatggtgaattgaacgatgttgct
agtgtcaagattgaaggttacccaactcttatcttatacccagctggtaagaattctgaa
cctgtagaattctctggtgctagagatttagaaacttttatcaatttcattaaagaaaac
ggtaaaaacagcgttgatggtaatgaagctttgacaagtttaagagaagaacaagaaaag
gctaaagccaaagaagaagaagaagctttagatttagatttagataacgatgatgaagat
gttgaagatgaattggaaaatgatgaattgtaa

DBGET integrated database retrieval system