KEGG   Tetrapisispora blattae: TBLA_0A06670Help
Entry
TBLA_0A06670      CDS       T02489                                 

Gene name
TBLA0A06670
Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tbl  Tetrapisispora blattae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1630701..1632023)
Genome map
AA seq 440 aa AA seqDB search
MEFTNNRKPLFIPSKTVPKLSQKELKQQQVTDKRVQQLLQSQLEKLKLKSHHLAGEPNRT
IDEENKFSLPSRYEIVHILGKGSYGTVCSARDNKNPENTYCIAVKKITNIFFREILLKRA
IRELKFINYFKGHKNIVNLIDLELVVEKPYEGLYCYQELIDYDLAKVIHSSVYLGEFHIK
FFFYQIVCGLKYIHSADVIHRDLKPGNILCTLNGCLKICDFGLARGVASKYFNTRVSHQD
ITNYVATRWYRAPELILSHKTYDKSIDMWSLGCILGEFYERRPLFMGKDAMNQIFQILQV
LGSPSKSLLKSFSSRYANSLCSDSNSNIEKQDWKKIFPNASMDAVDLLDRLLDWDPAERI
TINQAIEHPFFKDVRKIDDEPDCPYGSFDFTYEEKLDSMQKLREYLIVEVDNFKRERVIL
DNPTQNRLNNPQLIQNSYYK
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggaattcacaaataatcgtaaaccactcttcataccttcgaaaactgtacctaaactc
agtcaaaaggaacttaaacaacaacaagtaactgacaaacgagtacaacaattattacaa
tctcaattggaaaaattgaaattaaaatctcatcatctagctggtgaaccaaatagaaca
attgatgaagaaaataaattttctttacctagtagatatgaaatagttcatatcttaggt
aaaggttcatatgggactgtttgttcggctagagataataaaaatccagaaaatacgtat
tgtattgcagtgaaaaaaattacaaatattttctttagagaaattttattgaagagagct
attcgtgaattaaaatttattaattattttaaaggtcataaaaacattgttaacttaatt
gatttagaattagtagtagaaaaaccttatgaaggtttatattgttatcaagaattaatc
gattatgatttggcaaaagtgattcattcttcagtgtatttgggtgagttccatattaaa
tttttcttttatcaaattgtttgtggattaaaatatatccatagtgcagatgtcattcat
agagatttaaaaccaggaaatatattatgtactttaaatggctgtttaaaaatatgtgac
tttggtttagcaagaggtgtggcaagtaaatattttaatacaagagtttcacaccaagat
attacaaattatgttgcaacacgttggtatagagcacctgaattgattttatcccataaa
acatatgataaatctatagatatgtggtctctcggttgtatattaggtgaattttacgaa
agaaggccattattcatggggaaagatgcaatgaatcaaatatttcaaattctacaagtt
ttaggttctccttctaaatcacttttgaaatcttttagttcgagatatgcaaatagtctt
tgctctgattctaattcaaatattgagaaacaagattggaaaaaaattttcccaaatgca
tcaatggatgcagttgatttgttagatagattgctcgattgggatccagctgaacgtata
acaattaaccaagcaattgagcatccattctttaaagatgttaggaaaattgacgatgaa
cctgattgtccatatggatcatttgattttacatatgaggaaaaattagattcaatgcaa
aaattaagagaatatctaattgtagaagtcgataattttaaacgcgaaagagtaatcttg
gacaatcctactcaaaatcgtttaaataacccgcaattaattcaaaattcatattataaa
taa

DBGET integrated database retrieval system