KEGG   Tetrapisispora blattae: TBLA_0A07020Help
Entry
TBLA_0A07020      CDS       T02489                                 

Gene name
TBLA0A07020
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tbl  Tetrapisispora blattae
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TBLA_0A07020 (TBLA0A07020)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TBLA_0A07020 (TBLA0A07020)
Enzymes [BR:tbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TBLA_0A07020 (TBLA0A07020)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1716536..1718770)
Genome map
AA seq 744 aa AA seqDB search
MKFYNVELPCIKLLEKRKMLFFKLINNKTIIWKNGSKRLDIDSIKDVRTDSLARNYIEEY
GIDNTTAKWWVTLIYVINNNKLKCLHLVLNNEEEFKLFVSSILDIIKERRELMQSILVPD
HARFANIHWESTVSPKKEDEIKETLTFQDVQALCSKFNIVSSHSYLHKNFLLADVNNNGL
LNFAEFQTFVKLLKKRDEIDTLWKNITLNKNKMNFESFFDFISTKQGENITKKAALRLFK
QISQFKETINKDIFLKYLRNEPYTKNINENYSHPITDYFIASSHNTYLLGKQVAETPSVE
GYIQVLQQGCRSVEIDIWDSEIGPVVCHGLLTSAIPLSNVVTAIRKYAFITSPYPLIISL
EINCGPDNQLLTVKILREILGNSLLESIVDKHGIMSPRHLKHKIILKSKKCKHVEQQTPL
SSFSSYSSSHESEVEIRQRRKKSTASIERFRRIKLKHDFRVIDQLLEISAIHGIRFRNTS
LPESKTVNHCFSLNEKKIDKLCQDKTLKLAIDKHNRKFFMRVFPHVIRYKSSNFNPIQFW
KYGTQMVATNWQTYDIGQQLNIAMFQLTDQKNGILNSGYVLKPKYIREKTTNTKNIPLIY
EKIHQNKKKLIFNILSAQFLPSNDLKKGCTIAPYVIIEFFTTEITELNQDLQVHNGTKIS
DYKITTKTCPGNGFNPVWNCEMSINICDDSFTFIRLCVKSSDTTLGVICFKLDYLKRGYR
HVPLYNMEGERYVFSTVFLYSEIK
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttacaacgtggaattaccatgtataaaattactagaaaaaagaaaaatgtta
ttttttaaactaattaataacaagacaataatttggaaaaatggttccaaaagactggat
attgatagtatcaaagacgtaagaacagatagtttagcgagaaattatattgaagaatat
ggcattgataatactactgccaaatggtgggtaacattaatttatgtcataaacaataac
aagttaaaatgcttacatctagttttaaacaacgaagaagagttcaaattatttgtcagt
agtatcttagatattataaaagaacgaagagaattaatgcagagtattctagtaccagat
catgcaagatttgcaaatattcattgggaatcaactgtttctccaaaaaaagaagatgag
attaaagaaacattgactttccaagatgtccaagctttatgctcaaaatttaatatagtt
agttctcattcttatttgcataaaaattttctattagcagatgtcaataataatggtctt
ttaaacttcgcagaatttcaaacatttgtgaaactattgaaaaagagagatgaaattgat
actttatggaaaaacattactttaaacaaaaataaaatgaacttcgaaagtttttttgat
tttatttcaacgaaacaaggtgaaaatattacaaaaaaagctgctctaagactctttaaa
caaatatcacaatttaaagaaactattaataaggatatctttctgaaatatctccgaaac
gaaccatatacgaagaatattaatgaaaattattcgcacccaattactgattattttata
gcttcttcacataatacatatctgctggggaagcaagtggctgaaacacccagtgtagaa
ggatatattcaagtattacagcagggatgtagaagcgtcgaaattgatatatgggattct
gaaattggtccggtagtatgccatggtttattaacatctgcgattccattatctaatgtg
gttaccgctattagaaaatatgcctttatcacttctccttatccattaattatttcttta
gaaatcaattgtggcccagataatcaacttttaactgtaaaaatattacgggagattctt
ggaaacagcctattagaaagtatcgttgataaacatggaataatgtctccaagacatcta
aaacataaaattatcttaaaatcaaagaagtgtaaacacgtggaacaacaaactccctta
tcatcattttcgtcctatagttcttctcatgaatctgaagtagaaatacgacaaagaaga
aaaaaatcaactgcaagtatagaaagatttcggagaattaaactaaaacacgattttaga
gtaattgatcaattattagaaataagcgctatacatggtatcaggtttcgtaacacatct
cttcctgaatctaaaaccgtaaaccattgtttctcattaaatgaaaaaaaaattgacaaa
ctttgtcaagataaaactctaaagctagcaattgacaaacataatcgtaaatttttcatg
cgtgttttccctcatgtcattagatacaaatcatctaattttaatcctattcaattttgg
aagtatggtactcaaatggtagctactaattggcaaacatatgatataggccaacaatta
aatattgccatgtttcaattgacagaccaaaagaatggaatattaaactctggatatgta
ttgaaaccaaaatatattcgcgaaaaaactactaatacgaaaaatattccattaatatat
gaaaaaatacatcaaaataagaaaaaattaatttttaatatattaagtgctcaattttta
ccttctaatgatctgaaaaaaggatgtaccattgctccatatgtcattattgaatttttt
actaccgaaataactgaacttaaccaagatttacaagttcacaacggtaccaaaatcagt
gactataaaatcacaaccaaaacatgcccaggtaatggttttaatccagtctggaactgt
gaaatgtctattaacatatgtgacgattctttcacatttattagactgtgtgtaaaatca
agtgatacaactttaggtgttatatgttttaaattggattatttaaaaagagggtatcga
catgtacctctttataatatggagggtgaaagatatgtattttctacagtttttttatat
tcagaaataaaataa

DBGET integrated database retrieval system