KEGG   Tetrapisispora blattae: TBLA_0A08430Help
Entry
TBLA_0A08430      CDS       T02489                                 

Gene name
TBLA0A08430
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbl  Tetrapisispora blattae
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2075682..2076773)
Genome map
AA seq 363 aa AA seqDB search
MSRKITFDIPAHYQLLDLVGEGAYGTVCSACHLPTGTTVAIKRIQPFSKPLFVTRTLREI
KLLKYFNDHENIISILDQVKPNSIETFNSVYLVQELMETDLQKIIVNQKLSYDHIQYFIY
QILRALKSIHSAQVIHRDLKPSNLLLNSNCDLKVCDFGLSRCLASSDNSKDTLVGFMTEY
VATRWYRAPEIMLTFQKYTTAMDIWSCGCILAEMISGKPLFPGRDYHHQIWLILEVLGTP
SNDDFDDITSNRAKEYIENLPFKSKLPYEVALGRDDMDPLLIDLLDKMLTFNPHKRISAK
EALSHPYLATYHEPDDEPDYPPLDVEHDDFWQMDNSIKENTDEVPSIEFLKQMLYDEIQK
PLN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaaaaattacattcgatattcctgcacattatcaattgttagatttggttggt
gaaggtgcttatggtacagtttgttccgcttgtcatttaccaacaggtaccactgtggca
attaaaagaatacaaccgttcagtaaacctttatttgtaacaagaactttaagagaaatc
aaattgttgaaatatttcaatgatcatgaaaatatcatcagtatcttggatcaagtcaaa
ccaaattccattgaaaccttcaattctgtttatttggttcaagaattgatggaaactgat
ttacagaaaattatagtcaatcaaaaattatcttatgatcatattcaatatttcatctat
caaatattgagagctttaaaatcaattcatagtgctcaagtaatacatagggatttaaaa
ccatcaaatctattacttaattcgaattgtgatttaaaagtctgtgatttcggattatca
agatgtttagcaagtagtgataattcaaaagatactcttgtcggatttatgactgaatac
gtagctacaagatggtatagagctccagaaattatgttaaccttccaaaaatataccaca
gcaatggatatttggtcttgtggttgtatattagcagaaatgatctcagggaaaccttta
ttcccaggtagagattatcatcatcaaatttggttgattttagaagtattaggaactcca
tcaaatgatgatttcgatgatattacttcaaaccgtgccaaagaatatattgaaaattta
ccctttaaatcaaaactaccgtatgaagtagctctgggaagagatgatatggacccatta
ctaatagatttattagacaaaatgttgacttttaacccgcataaaagaattagtgctaaa
gaggccttgtcccatccttatttagcaacatatcatgaaccagatgatgaaccagattat
ccgcctttagatgtcgaacatgatgatttctggcaaatggataattcaattaaagaaaat
accgatgaagttccatccattgaattcttaaaacaaatgttgtacgatgagatacagaag
cctttgaattaa

DBGET integrated database retrieval system