KEGG   Tetrapisispora blattae: TBLA_0A08810Help
Entry
TBLA_0A08810      CDS       T02489                                 

Gene name
TBLA0A08810
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TBLA_0A08810 (TBLA0A08810)
Protein kinases [BR:tbl01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   TBLA_0A08810 (TBLA0A08810)
Exosome [BR:tbl04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TBLA_0A08810 (TBLA0A08810)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2161249..2162304
Genome map
AA seq 351 aa AA seqDB search
MGKKIVFNISSEFQLKSLLGEGAYGIVCSAVYKPTGEIVAIKKIEPFEKPLFALRTLREI
KILKHFQHENIISIFDIQRPESFENFNEVYIIQELMQTDLHRVISTQTLTDDHIQYFLYQ
TLRAVKTLHGSNVIHRDLKPSNLLINSNCDLKICDFGLARIDNGNEPNEGKTPETSAMTE
YVATRWYRAPEVMLTAAKYSKAMDVWSCGCILAELFLKRPIFPGKDYRHQLMLIFGFLGT
PTMDDLECIESKRARDYISSLPKYKAVNLEKTFPNVNPLGLDLLHKMLLFNPNNRITAEQ
ALEHPYLRTYHEPNDEPEGEPIPPSFFVFDNYKDSLTTKDLKKLLWNEIFN
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaaaaattgtctttaatatttcaagtgaatttcaattgaaatccttactaggt
gagggtgcttatggtattgtttgctctgcagtttataaaccaactggggaaatagtagca
ataaaaaaaattgaaccatttgaaaaaccattatttgctttacgtacattgagagaaata
aaaattttaaagcacttccagcatgaaaatatcatctcaatttttgatattcaaagacca
gagagctttgaaaattttaatgaagtatatattattcaagagctgatgcaaacagatttg
catcgtgttatatctactcaaacattaactgatgatcatattcaatattttttatatcaa
acattaagggcagtaaaaactttgcatggttcaaatgtaattcatagagatttaaaacct
tcaaatttactaattaattcaaactgtgatttaaaaatatgtgacttcggtttagcaaga
attgataatgggaatgagcctaatgaggggaaaacaccagagactagtgcaatgacagaa
tatgtagcaacaagatggtatagagcccctgaagtaatgcttactgctgccaagtattca
aaggctatggatgtctggtcgtgtggctgtatacttgcagaattattccttaaaagacct
atttttcctggtaaagattatagacatcaattaatgttaatttttggattcttaggaact
ccgactatggacgatctagagtgtattgagtctaaaagagcaagagattatatttcgagt
ttgccaaaatacaaagcagtaaatttagaaaaaacatttccaaatgtgaatccactagga
ttagatctattgcataagatgctactatttaacccaaataatagaatcactgcggaacaa
gcactggagcacccatatttaagaacttatcatgaaccaaatgatgaaccagaaggggag
ccaatacccccaagtttttttgtttttgataattataaggattcattgacaacgaaagat
ttaaagaagctgctttggaacgagattttcaattaa

DBGET integrated database retrieval system