KEGG   Tetrapisispora blattae: TBLA_0A10290Help
Entry
TBLA_0A10290      CDS       T02489                                 

Gene name
TBLA0A10290
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tbl  Tetrapisispora blattae
Brite
Enzymes [BR:tbl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TBLA_0A10290 (TBLA0A10290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2535936..2538005
Genome map
AA seq 689 aa AA seqDB search
MHSSDIIAIGAVILVALLYHYKNTILEIIFSDDSDISVEGGGGRDIAQVIRDNNKNYLVL
YGTQTGTAEDYAKRFSKELVNKFGLNVLCVDVENYDFDTLNELPEDVIVSFFFSTYGEGE
FPDGAIGFEQYLQNASMGSLSNIRFTLFGLGNSTYEFFNGASKKALEGLTAAGAIQVSAI
GEADDANGTTDEDYLSWKENTFDKLKELLNLKESNDGFKPSYKINILDKMPTNASTGEPS
KNYIDSSRIKYDSNGLQMGPFSESYPFLAPVKTSRELFNSNDRNCIHMEIDISGSNMNYS
TGDHLGVLPSNSNENVESFINTFCLDPNMIFELNSIDSTMKLPFPTPTTVESAIRYYLEI
SGPISRAILSNLVEFAPDETTKLKLLKLSKDKKLFEKEVTSKKLNLCDILMVLSGKVKWG
NVPFLFLIENIPHIQPRYYSISSSSNSEKTLVNITAVVEDMPNIETNINVTGVTTNLLRN
IQLEQNKTDTTDARINNLNQHYDLDGPRSLYSNFKLPVFVRKSTFRLPANYQKPVIMIGP
GTGVAPFRGFIRDRVYEVSNGKIPDLNSLGKHLLFYGSRNESDHLYQEEWPKYSSILNKK
FEMIVCHSRIPNTKKVYVQDKLLEYSKEILQLLNDGGYIYICGDAKGMAKGVHASLVQIL
SQGKGISEEESNEILKAMKLSGTIQEDVW
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atgcattcatctgatattattgctattggtgcagttattttggtggctttactgtatcat
tataaaaacacaattttagaaattattttttctgatgatagcgatatcagtgttgaaggg
ggtggtggtcgtgatattgctcaagtaattcgggataataataagaattatttggtacta
tacggcactcaaactggtactgctgaggattatgccaaaagattttccaaagaattggtt
aacaagtttgggttaaatgttttatgtgtggatgtggaaaattatgacttcgatacctta
aatgaattaccagaggatgttatcgtgtcatttttcttttctacctatggtgaaggtgaa
ttcccagatggtgctattggatttgagcaatatttacaaaatgcctcaatgggcagttta
agtaatattaggttcacattatttggcctgggtaattctacttacgaattctttaatggt
gcctctaaaaaagctttagagggtttaactgctgctggtgctattcaagtgtctgccatt
ggtgaagcagatgacgcaaacggcactactgatgaagattatttatcttggaaggaaaac
acttttgataaattaaaagaactactaaatttgaaggaaagcaacgatggatttaaacct
tcttacaagataaatattttggataaaatgcccacaaacgcttcaacaggtgaaccttct
aaaaattatatcgatagttccagaattaaatatgattcaaatggtttacaaatgggacct
ttcagtgaatcttatcccttcttagcccctgtaaagacatctcgcgaattgtttaactct
aatgaccgtaactgcattcatatggaaattgatattagtggttccaatatgaactattcc
actggggatcatttaggtgttttaccttccaactctaatgaaaacgtggaaagctttata
aataccttttgccttgatcctaacatgatttttgaattgaactcaattgattctaccatg
aaactcccattcccaactccaactactgtcgagtcagcaataagatattacttggaaatt
tcaggcccaatttctagagcgatcttatctaaccttgtggagtttgcccccgatgaaact
acaaaattgaaattactaaaattatccaaggataagaaactatttgaaaaagaagttaca
tccaaaaaattaaatttatgtgatattttaatggttttatctggaaaagttaaatggggt
aatgtaccatttctattcctaattgaaaacatccctcacattcaaccacgttattactca
atttcatcatcatctaattcagaaaagactttagttaatattacagccgtagtagaagat
atgccaaatatagaaacaaatattaatgtcacaggtgtaaccacaaacttattgaggaat
attcaactagaacaaaataaaaccgatacaactgatgctagaataaacaatttaaatcaa
cattatgatttagatggtccacgtagtttatattctaatttcaaattaccagtatttgtg
agaaaatctacatttagattaccggctaattaccaaaagcctgtgattatgattggacca
ggtacaggtgttgcaccattccgtgggtttattagagatcgtgtttatgaagtttctaat
ggcaaaattccagatttaaactccttgggtaaacatttattattttatggctcaagaaat
gaaagcgatcatttatatcaagaagaatggccaaaatattcttccatactgaataagaaa
tttgaaatgatagtttgtcattcaagaatccccaataccaagaaagtttatgttcaagat
aagctgttagaatatagtaaagaaattttgcaattactaaatgacggtggctatatatat
atttgtggtgatgccaagggtatggccaaaggtgttcatgcatctttagtgcaaattctt
tcccaaggtaagggtatctctgaagaggaaagtaatgaaatattgaaagctatgaaactt
tcaggtactatacaagaagatgtttggtga

DBGET integrated database retrieval system