KEGG   Tetrapisispora blattae: TBLA_0A10670Help
Entry
TBLA_0A10670      CDS       T02489                                 

Gene name
TBLA0A10670
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tbl  Tetrapisispora blattae
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tbl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TBLA_0A10670 (TBLA0A10670)
Enzymes [BR:tbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     TBLA_0A10670 (TBLA0A10670)
Glycosyltransferases [BR:tbl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TBLA_0A10670 (TBLA0A10670)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2637830..2640181)
Genome map
AA seq 783 aa AA seqDB search
MAVIKRNHKGKNNSNNNLSAQNSEKSIENKLELDDDKKYKTLATKSNNNFKYIGERWLTS
PLPAPEWHYTLWRSIVTLVAFIVRFYKIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPP
FAKMLIAFIGYLRGYDGSFKFDEIGYSYETNPAPYLAYRCFNALLGTLTVPIMFNTLKEM
NFKAVTCAFAGFLVALDNAHIVETRLILLDATLIISVAASIYCYVRFYKAQLKAPFSYSW
FFWLYLTGLSLSFVISTKYVGVFTFVMVGIAVLVNLWQLLDIRASLNMKTYIKHFTRRVS
GLILAPFMVYLFWFWVHFSVLTKSGPGDSFMSFDFQETLSDSPMARETKQVNYYDIVTFE
HKDTNTFLHSHLANYPLRYEDGRISSQGQIVTTSDDAADVFNQWEILPTKELESTTGQPV
RLNEHIRLRHVATNTYLLAHDVASPFYPTNEEIVTVSEEDANDSKYAQTLFMLQALKKND
GNRIVNTRGTVFRLFHVDTAVALWSHNDVYLPEWAGENQQEVNGNKKVTEPSNNWLINSI
TNLNDDRLVYIPKQVKKLPFLTKWWEAQRLMFEHNNKLSSEHPFASQPYSWPGSLSGVSF
WTKDSERVQIYFIGNIFGWWAEIISLAVYLGLIIVDLISRQRGVYILNALTRDKIYGPLM
YLFAGWCFHYFPFYLMARQKFLHHYLPAHLIAALFTGALWETIFTDCRNANPEVDEGEDS
DTVFAQPKLYLKYYGFFLILMLVGLTACFIFFAPLSYGDISLDSAALIRRQWFNIKLNYI
KQS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcagttatcaagagaaatcataaaggtaagaacaatagtaataataacttatcggct
caaaattctgaaaaatcaattgaaaacaagttagaattagatgatgataagaaatataaa
actttagctacaaaatcaaataataattttaaatatattggtgaaagatggctaacaagt
ccattacctgctccagaatggcattatactctatggagaagtatcgtaactttagtagct
tttattgtaagattttataaaatttggtatccaaaggaagtcgtatttgatgaagtccat
tttggtaaattcgcctcatattatttagaaagaacatatttctttgacgttcatccacca
ttcgctaaaatgttgattgcatttattggttatttacgtggttatgatggttctttcaaa
tttgatgaaattggttatagttatgaaacaaatccagctccttacttggcttatcgttgt
ttcaatgcattattaggtaccttaactgttccaattatgtttaatacattaaaagaaatg
aattttaaggcagtcacttgtgcatttgcagggtttttagtcgccttagataatgcacat
attgtagaaacaagattaatattgctagatgctacattgatcatctctgtagctgctagc
atttactgttatgttcgcttctataaagctcaattaaaggcaccattctcatattcttgg
ttcttttggctatatttaactggattatctttatcctttgttatttcaacaaaatatgtt
ggtgtttttacttttgtaatggtaggcattgctgtacttgttaatttatggcaactatta
gatattcgtgctagtttgaatatgaaaacttacattaaacatttcactagaagagtttct
ggcttaatactggctccatttatggtttatttattttggttttgggttcacttctctgtt
ttaacaaaatctggcccgggtgattctttcatgtcatttgattttcaagaaactttaagt
gactctccaatggctcgtgaaactaaacaagttaattattatgatatcgttacctttgag
cataaagatactaatacttttttacactcccatctagccaattatcccctaagatatgaa
gatggtagaatatcttcccaaggccaaatcgttacaacttctgatgatgctgctgatgtt
tttaatcaatgggaaattttaccaacgaaggaattagaatctaccactggccaacctgtt
cgtttgaatgaacatattagattaagacacgttgccacaaatacttatttgttagctcat
gatgttgcttcaccattttatccaacaaatgaagaaattgttacagtttctgaagaagac
gcaaatgattctaaatatgctcaaactttatttatgttacaagcactaaagaaaaatgat
ggaaatagaattgttaatacaagaggtacagtattccgtcttttccacgtagatactgct
gttgctttatggtcacacaacgatgtgtacttacctgaatgggctggtgaaaatcagcaa
gaagttaatggtaataagaaagtcactgagccatctaataattggcttatcaattcaatt
acaaacttgaatgatgacagattggtttatatcccaaagcaagttaagaaattaccattc
ctcactaaatggtgggaagcacagcgtttaatgtttgaacataataacaaattgagttct
gaacatccattcgcatctcaaccttattcttggcctggttccctgagcggtgtttcattc
tggacaaaggattcagaaagagttcaaatttactttattggtaacatatttggttggtgg
gctgaaattatttctttagctgtttatctaggccttattattgttgatttaatctctaga
caacgtggggtctacattttgaatgcactaactagagacaaaatatatggtcctttaatg
tacctgtttgctggctggtgtttccattacttcccattctatttaatggctcgtcagaaa
tttttacaccattacttgcctgctcatttgattgctgcactatttaccggtgccctttgg
gaaaccatattcactgattgcagaaatgcaaatcctgaagttgatgagggagaagatagt
gacactgtttttgcccagccaaaattatatctgaaatattatggattcttcctaatatta
atgttggtcggattaacggcatgttttatattttttgcaccattatcttacggtgatatt
tcgttagactcagctgctcttatcagaagacaatggtttaatattaaattaaattatatt
aagcaaagttga

DBGET integrated database retrieval system