KEGG   Tetrapisispora blattae: TBLA_0A10670Help
Entry
TBLA_0A10670      CDS       T02489                                 

Gene name
TBLA0A10670
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tbl  Tetrapisispora blattae
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:tbl00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2637830..2640181)
Genome map
AA seq 783 aa AA seqDB search
MAVIKRNHKGKNNSNNNLSAQNSEKSIENKLELDDDKKYKTLATKSNNNFKYIGERWLTS
PLPAPEWHYTLWRSIVTLVAFIVRFYKIWYPKEVVFDEVHFGKFASYYLERTYFFDVHPP
FAKMLIAFIGYLRGYDGSFKFDEIGYSYETNPAPYLAYRCFNALLGTLTVPIMFNTLKEM
NFKAVTCAFAGFLVALDNAHIVETRLILLDATLIISVAASIYCYVRFYKAQLKAPFSYSW
FFWLYLTGLSLSFVISTKYVGVFTFVMVGIAVLVNLWQLLDIRASLNMKTYIKHFTRRVS
GLILAPFMVYLFWFWVHFSVLTKSGPGDSFMSFDFQETLSDSPMARETKQVNYYDIVTFE
HKDTNTFLHSHLANYPLRYEDGRISSQGQIVTTSDDAADVFNQWEILPTKELESTTGQPV
RLNEHIRLRHVATNTYLLAHDVASPFYPTNEEIVTVSEEDANDSKYAQTLFMLQALKKND
GNRIVNTRGTVFRLFHVDTAVALWSHNDVYLPEWAGENQQEVNGNKKVTEPSNNWLINSI
TNLNDDRLVYIPKQVKKLPFLTKWWEAQRLMFEHNNKLSSEHPFASQPYSWPGSLSGVSF
WTKDSERVQIYFIGNIFGWWAEIISLAVYLGLIIVDLISRQRGVYILNALTRDKIYGPLM
YLFAGWCFHYFPFYLMARQKFLHHYLPAHLIAALFTGALWETIFTDCRNANPEVDEGEDS
DTVFAQPKLYLKYYGFFLILMLVGLTACFIFFAPLSYGDISLDSAALIRRQWFNIKLNYI
KQS
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcagttatcaagagaaatcataaaggtaagaacaatagtaataataacttatcggct
caaaattctgaaaaatcaattgaaaacaagttagaattagatgatgataagaaatataaa
actttagctacaaaatcaaataataattttaaatatattggtgaaagatggctaacaagt
ccattacctgctccagaatggcattatactctatggagaagtatcgtaactttagtagct
tttattgtaagattttataaaatttggtatccaaaggaagtcgtatttgatgaagtccat
tttggtaaattcgcctcatattatttagaaagaacatatttctttgacgttcatccacca
ttcgctaaaatgttgattgcatttattggttatttacgtggttatgatggttctttcaaa
tttgatgaaattggttatagttatgaaacaaatccagctccttacttggcttatcgttgt
ttcaatgcattattaggtaccttaactgttccaattatgtttaatacattaaaagaaatg
aattttaaggcagtcacttgtgcatttgcagggtttttagtcgccttagataatgcacat
attgtagaaacaagattaatattgctagatgctacattgatcatctctgtagctgctagc
atttactgttatgttcgcttctataaagctcaattaaaggcaccattctcatattcttgg
ttcttttggctatatttaactggattatctttatcctttgttatttcaacaaaatatgtt
ggtgtttttacttttgtaatggtaggcattgctgtacttgttaatttatggcaactatta
gatattcgtgctagtttgaatatgaaaacttacattaaacatttcactagaagagtttct
ggcttaatactggctccatttatggtttatttattttggttttgggttcacttctctgtt
ttaacaaaatctggcccgggtgattctttcatgtcatttgattttcaagaaactttaagt
gactctccaatggctcgtgaaactaaacaagttaattattatgatatcgttacctttgag
cataaagatactaatacttttttacactcccatctagccaattatcccctaagatatgaa
gatggtagaatatcttcccaaggccaaatcgttacaacttctgatgatgctgctgatgtt
tttaatcaatgggaaattttaccaacgaaggaattagaatctaccactggccaacctgtt
cgtttgaatgaacatattagattaagacacgttgccacaaatacttatttgttagctcat
gatgttgcttcaccattttatccaacaaatgaagaaattgttacagtttctgaagaagac
gcaaatgattctaaatatgctcaaactttatttatgttacaagcactaaagaaaaatgat
ggaaatagaattgttaatacaagaggtacagtattccgtcttttccacgtagatactgct
gttgctttatggtcacacaacgatgtgtacttacctgaatgggctggtgaaaatcagcaa
gaagttaatggtaataagaaagtcactgagccatctaataattggcttatcaattcaatt
acaaacttgaatgatgacagattggtttatatcccaaagcaagttaagaaattaccattc
ctcactaaatggtgggaagcacagcgtttaatgtttgaacataataacaaattgagttct
gaacatccattcgcatctcaaccttattcttggcctggttccctgagcggtgtttcattc
tggacaaaggattcagaaagagttcaaatttactttattggtaacatatttggttggtgg
gctgaaattatttctttagctgtttatctaggccttattattgttgatttaatctctaga
caacgtggggtctacattttgaatgcactaactagagacaaaatatatggtcctttaatg
tacctgtttgctggctggtgtttccattacttcccattctatttaatggctcgtcagaaa
tttttacaccattacttgcctgctcatttgattgctgcactatttaccggtgccctttgg
gaaaccatattcactgattgcagaaatgcaaatcctgaagttgatgagggagaagatagt
gacactgtttttgcccagccaaaattatatctgaaatattatggattcttcctaatatta
atgttggtcggattaacggcatgttttatattttttgcaccattatcttacggtgatatt
tcgttagactcagctgctcttatcagaagacaatggtttaatattaaattaaattatatt
aagcaaagttga

DBGET integrated database retrieval system